EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01503 alignment
(17 sequences with 97 aa)


O59667_SCHPO/303-387 LCQLEKTLIDRKNNAPEGSYTARLFSD-----PKLLRAKIMEEAEELCDATTK--..---ENVIWEMADLMYFAITRCVGSGVSLNDISRHLDLKHR
HIS2_NEUCR/300-384 LPKLEQTLISRKQSAPEGSYTARLFSD-----EKLVRAKIMEEAEELCTAQTP--..---QEIAFEAADLFYFALTRAVAAGVTLADIERSLDAKSW
HIS2_SACBA/245-329 LVGLESLLKQRLQDAPKESYTRRLFND----P-ALLDAKIKEEAEELTEAKGK--..---QEISWEAADLFYFALAKLVTNNVSLKDVENNLNMKHL
HIS2_KLULA/241-325 LYGLQKLLQERLLNAPEGSYTKRLFND----S-DLLTAKIKEEAEELTEAVDK--..---KDIAWECADLFYFAMARLVANGVSLEDVERNLNTKHL
HIS2_PICPA/290-374 LRAMEATLWDRKSNAPEGSYTKRLFDD----E-VLLNAKIREEADELAEAKSK--..---EDIAWECADLFYFALVRCAKYGVTLDEVERNLDMKSL
HIS2_METTH/7-96 LREVYRVLEDR-RDRPIDSYTSRLMRDDDKMAEDKILEKIGEEAAEVIIASKND-..---ENLVEEAADLIFHTLLLLVYKGVPLDSLLEEFAARRK
HIS2_METJA/3-95 LEEVYEIIKQRIKEKPEGSYVAKLTTDDKKTAINKICEKIGEESTELILAAKDDK..--KDEIIYEAADLIFHTMVLLAYKNIEFEELLKEFERRKK
HIS2_SYNY3/127-215 LTELARVIGDRRDHPTPESYTCKLLAG----GDNKILKKIGEESAEVVMACKD--..DDPEAIAGEVADLFYHTLVALAHHNVDLRAVYRKLGDRRR
HIS2_BACSU/117-205 MNELERVIAERQAEMPEGAYTTYLFRE----GVDKILKKVGEEASEVIIAAKN--..RDHEELKWEAADLLYHLLVLLREQSLPLDDVLDVLKKRHS
HIS2_LACLA/110-198 FSELEKQIIDRKLHPVEKSYTNYLLGE----GIDKVLKKVGEEASEVIIASKN--..SDKGELLGEIDDLLYHLFVLMNQQGISLEEVRQKAKERHQ
HIS2_AZOCH/5-97 LNQLAEVLEARKNAAPDSSYVASLYHK----GLNKILEKVGEESVETILAAKDAAasGDCSELIYETADLWFHSLVMLAALGQHPQAVLDELERRFG
HIS2_RHOCA/4-92 LSRLAATVEARKGADPESSWTAKLFAK----GPEKCAEKFGEEAVEAIIAAVK--..NDRANLVYEAADVLYHLTVMLAARDVSLDEVLAELDRRAG
HIS2_AZOBR/11-99 LDRLYATVQARKGADPETSYTAKLFHR----GTAKIAQKVGEEAVETVIEAVR--..GDKAAMASESADLLYHLMVLWADAGLEPAAVWEKLAQREG
HIS2_HAEIN/122-210 FIKLEQHLKEKKNADPSNSYTATLHAK----GTKKIAQKVGEEGVETALAAVA--..QDKAEVISEATDLVYHLTVLLHNQDLQWYEIIAKLQERHQ
HIS2_ECOLI/115-203 LYQLEQLLAERKSADPETSYTAKLYAS----GTKRIAQKVGEEGVETALAATV--..HDRFELTNEASDLMYHLLVLLQDQGLDLTTVIENLRKRHQ
HIS2_SULSO/9-97 VDELYKIILDRIEKRPTGSYTAEIVNK----GKPYVARKVGEESVETIVASLAE-..-NKERFISEVADLIYHLLVLMALEGVTPEDIYRELERRRK
HIS2_AQUAE/117-205 LPRLQDVIREKIERKEENSYTAKLVSQ----GKERVFQKFGEEAVETLIALMK--..GEKEEVIYESADMLYTFLVSLSVSGIDIKEVMEELIRRFK