EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01470 alignment
(9 sequences with 212 aa)


PCP_PSEFL/2-202 RIVLLTGFEPFDQDPVNPSWEAVRQLDGVQLGSDVKIVARRLPCAFATAGECLTRLIDELHPAMVIATGLGPGRSDISVERVAININDA-R--IPDNLGEQPIDTAVVADGPAAFFTTLPIKAMVKAVREAGIAASVSQTAGTFVCNQVFYLLQHALAGSG--VRSGFIHVPFLPEQVAGSQ-R-----PSMALDAMVAGLQAAVLTAWHTP
PCP_BACSU/3-204 KKVLITGFDPFDKETVNPSWEAAKRLNG-FETEEAIITAEQIPTVFRSALDTLRQAIQKHQPDIVICVGQAGGRMQITPERVAINLADA-R--IPDNEGHQPIDEEISPDGPAAYWTRLPVKRMTAKMKEHGIPAAVSYTAGTFVCNYLFYGLMDHISRTSPHIRGGFIHIPYIPQQTIDKT-A-----PSLSLDTIVRALRIAAVTAAQYD
PCP_STAAU/1-202 MHILVTGFAPFDNQDINPSWEAVTQLE--NIIGTHTIDKLKLPTSFKKVDTIINKTLASNHYDVVLAIGQAGGRNAITPERVAINIDDA-R--IPDNDDFQPIDQAIHLDGAPRYFSNLPVKAMTQSVINQGLPGALSNSAGTFVCNHVLYHLGYLQDKHYPHLRFGFIHVPYIPEQVVGKSDT-----PSMPLEQIVAGLTAAIEAISDHD
PCP_STRPY/1-202 MKILVTGFDPFGGEAINPALEAIKKLP--ATIHGAEIKCIEVPTVFQKSADVLQQHIESFQPDAVLCIGQAGGRTGLTPERVAINQDDA-R--IPDNEGNQPIDTPIRADGKAAYFSTLPIKAMVAAIHQAGLPASVSNTAGTFVCNHLMYQALYLVDKYCPNAKAGFMHIPFMMEQVVDKPNT-----AAMNLDDITRGIEAAIFAIVDFK
PCP_LACLC/1-202 MKILVTGFDPFGDDKINPAIEAVKRLP--DEIAGAQIVKLEIPTKFNVSADVVKDAIAKEKPDYVLSIGQAGGRFELTPERVAINLDDG-R--IQDNAGYQPLNHTIHGDDENAYFTQLPIKAMAKAIREAGVPSAVSNTAGTYVCNHIFYQVQYMRDKMFPDIKAGFMHIPFLPEQVVTRPET-----PALSLDDDVLGITAAIKAIVSRD
PCP_PYRFU/1-207 MKVLVTGFEPFGGEKINPTERIAKDLDG-IKIGDAQVFGRVLPVVFGKAKEVLEKTLEEIKPDIAIHVGLAPGRSAISIERIAVNAIDA-R--IPDNEGKKIEDEPIVPGAPTAYFSTLPIKKIMKKLHERGIPAYISNSAGLYLCNYVMYLSLHHSATKGYPKMSGFIHVPYIPEQIIDKIGK-GQVPPSMCYEMELEAVKVAIEVALEEL
PCP_THELI/2-209 KKVLITGFEPFGGDSKNPTEQIAKYFDR-KQIGNAMVYGRVLPVSVKRATIELKRYLEEIKPEIVINLGLAPTYSNITVERIAVNIIDA-R--IPDNDGYQPIDEKIEEDAPLAYMATLPVRAITKTLRDNGIPATISYSAGTYLCNYVMFKTLHFSKIEGYPLKAGFIHVPYTPDQVVNKFFLLGKNTPSMCLEAEIKAIELAVKVSLDYL
PCP_PYRHO/1-200 MKILLTGFEPFGGDDKNPTMDIVEALSE-R-IP--EVVGEILPVSFKRAREKLLKVLDDVRPDITINLGLAPGRTHISVERVAVNMIDA-R--IPDNDGEQPKDEPIVEGGPAAYFATIPTREIVEEMKKNGIPAVLSYTAGTYLCNFAMYLTLHTSATKGYPKIAGFIHVPYTPDQVLEKKNT-----PSMSLDLEIKGVEIAIRVAQSAL
PCP_MYCTU/2-209 SKVLVTGFGPYGVTPVNPAQLTAEELDG-RTIAGATVISRIVPNTFFESIAAAQQAIAEIEPALVIMLGEYPGRSMITVERLAQNVNDCGRYGLADCAGRVLVGEPTDPAGPVAYHATVPVRAMVLAMRKAGVPADVSDAAGTFVCNHLMYGVLHHLAQKGLPVRAGWIHLPCLPSVAALDHNLG---VPSMSVQTAVAGVTAGIEAAIRQS