EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01466 alignment
(16 sequences with 86 aa)


Q21367_CAEEL/80-161 LTAWDVQFIR.TNSAILLHLAEAAFRLEIVGLLDVACRAVSIML-GRTLNEVKLMLRVGGVESPSD..EEDSLEDVLELEVDVDEN
Q21969_CAEEL/89-165 FSEWDKQFFN.VESGVLFALLNASHALGVEDLMNMGCAAAAELIRGKSTEEIRKIYGIRSD---EE..---QMEEALANGGEGTSA
Q89374_CHVP1/68-145 IKDFDKGFVN.INMDFMFDLIQGANFLNIKGLLDVLCAAVADRIRGKTPEQIREVFGIENDLTPEE..-----EAAALAEHSWTHL
CBF3D_YEAST/115-192 VDSWDREFLK.VDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTPEE..-----EAAIRRENEWAED
Q92229_EMENI/83-160 IEEWDQKFMQ.VDQEMLFEIILAANYLDIKPLLDIGCKTVANMIKGKSPEEIRKTFNIQNDFTPEE..-----EDQIRRENEWAED
SKP1_HUMAN/84-161 IPVWDQEFLK.VDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEE..-----EAQVRKENQWCEE
Q39255_ARATH/83-160 LKAWDADFMK.IDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEEIRTTFNIKNDFTPEE..-----EEEVRRENQWAFE
O81057_ARATH/71-149 FKTWDEEFMKkFDQPTVFQLLLAANYLNIKGLLDLSAQTVADRIKDKTPEEIREIFNIENDFTPEE..-----EAAVRKENAWAFE
O45517_CAEEL/90-167 ISEWDAEFMK.VDQGTLFEIILAANYLDIRGLLDVTTQNVANMMKGKTPSQIRTLFNIENDFSEEE..-----REAMKKENAWCED
Q93731_CAEEL/97-174 IQDWDKKFLD.IDQGTLFELILAANYLDIKGLLDVACQSVANMIKGKSPDEIRRAFNIKDDFTAEE..-----REQIRKENAWCDD
O81058_ARATH/112-190 LNEWDAKFMKdFDIKTIFDIILAANYLNVQGLFDLCSKTIADYIKDMTPEEVRELFNIENDFTPEE..-----EEAIRNENAWTFE
O81055_ARATH/89-167 LRTWDAEFMKeFDMETVMKLILAVNYLNVQDLLGLTCQTVADHMKDMSPEEVRELFNIENDYTPEE..-----EDAIRKENAWAFE
Q17696_CAEEL/107-180 IPSWDRHFLSrLPMSNLFDLITAAYHLDVTGLINYGCKTVANSAKGKNAEEMRELFGI-----PEP..----WEQPSTSTATWDD-
O45357_CAEEL/105-189 VPQWDADFLK.ISSDVLFDLIVACNELDVPGLMNYGCKMVADMAAGKSPEDMRTIYGIPTDKQDADaaEKAAKEEAEKNATAQRDE
Q22871_CAEEL/96-170 IPEWDQKFLK.IEDEALFDLILASNFLDIKGLMYFGCKTVSNMAKGKTTAELREIFGINTDEQDAA..-----EETAQRA---AAE
Q21968_CAEEL/88-155 IPDWDASFLM.VRHNMLFDIIRAARDFTVPGLFAMCCRVVG-----QNPREI--IDGLVND---EE..-----EEQPVYPVKKCKN