EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01452 alignment
(3 sequences with 175 aa)


VS10_ROTHW/1-174 MDKLADLNYTLSVITSMNDTLHSIIQDPGMAYFLYIASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEWESGKNPYEP-SEVTAS
O11981_9REOV/1-174 MEKLADLNYTLGVITLLNDTLHNILEEPGMVYFPYIASALTVLFTMHKASLPAMKLAMRTSQCSYRIIKRVVVTLINTLLRLGGYNDYLTDKDETEKQINRVVKELRQQLAMIEKLTTREIEQVELLKRIYDMMVVRQNREIDMSKETNQKAFKTLHDWGNDRN-YDDNTDVIAP
O55588_9REOV/1-169 MENATTINETLVEEVYNMTMSYFEHNVIIMKYFPFLASILTIAFTAWKMGKSTFKVTKTVAGSGFKIVRVVVITIFNCVMRLFGSKTEVVSDDRLDALASKILAQIDNQVKVIEQLTKRELEQVKLLADIYEMLKFKK-DEIDMSFETNKK---EYEKWVKDP--YQPTRAVSLD