EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01413 alignment
(26 sequences with 118 aa)


O18407_DROME/1513-1622 GFIFARHSQSVHVPQCPANTNLLWEGYSLSGNVA-ASRAVGQDLGQSGSCMMRFTTMPYMLCDI.TNVCHFAQNNDDSLWLSTAEP-----.MPMTMTPIQGRDLMKYISRCVVCETT
CO4A1_DROME/1554-1658 GILITRHSQSETVPACSAGHTELWTGYSLLYVDG-NDYAHNQDL---GSCVPRFSTLPVLSCGQ.NNVCNYASRNDKTFWLTTN-------.AAIPMMPVENIEIRQYISRCVVCEAP
Q26640_STRPU/1526-1633 GHFITRHSQSRNVPSCPAGTVELWRGFSVLFSMG-NGHAHHQDLGDAGSCLQRFSTMPFLFCNF.NNVCNYASRNDRSYWLTTN-------.EPLPMMPLMNQQIDPYISRCTVCEAP
CO4A2_CAEEL/1531-1638 GFVLVKHSQTTEVPRCPEGQTKLWDGYSLLYIEG-NEKSHNQDLGHAGSCLQRFSTMPFLFCDF.NNVCNYASRNEKSYWLSTS-------.EAIPMMPVNEREIEPYISRCAVCEAP
CO4A4_HUMAN/1465-1572 GFLLVLHSQTDQEPTCPLGMPRLWTGYSLLYLEG-QEKAHNQDLGLAGSCLPVFSTLPFAYCNI.HQVCHYAQRNDRSYWLASA-------.APLPMMPLSEEAIRPYVSRCAVCEAP
CO4A2_HUMAN/1489-1596 GYLLVKHSQTDQEPMCPVGMNKLWSGYSLLYFEG-QEKAHNQDLGLAGSCLARFSTMPFLYCNP.GDVCYYASRNDKSYWLSTT-------.APLPMMPVAEDEIKPYISRCSVCEAP
CO4A6_HUMAN/1467-1574 GYTLVKHSQSEQVPPCPIGMSQLWVGYSLLFVEG-QEKAHNQDLGFAGSCLPRFSTMPFIYCNI.NEVCHYARRNDKSYWLSTT-------.APIPMMPVSQTQIPQYISRCSVCEAP
CO4A5_HUMAN/1461-1570 GFLITRHSQTTDAPQCPQGTLQVYEGFSLLYVQG-NKRAHGQDLGTAGSCLRRFSTMPFMFCNI.NNVCNFASRNDYSYWLSTPEP-----.MPMSMQPLKGQSIQPFISRCAVCEAP
CO4A1_HUMAN/1445-1554 GFLVTRHSQTIDDPQCPSGTKILYHGYSLLYVQG-NERAHGQDLGTAGSCLRKFSTMPFLFCNI.NNVCNFASRNDYSYWLSTPEP-----.MPMSMAPITGENIRPFISRCAVCEAP
Q07265_STRPU/1528-1637 GFFITRHSQTTSIPQCPQGTAKMWHGYSLLFVQG-NERGHGQDLGKPGSCLKRFSTMPFLFCNI.NNVCHVASRNDYSYWLSTTEP-----.MPMNMAPIRGGQLQPFISRCVVCEAP
CO4A3_HUMAN/1445-1554 GFVFTRHSQTTAIPSCPEGTVPLYSGFSFLFVQG-NQRAHGQDLGTLGSCLQRFTTMPFLFCNV.NDVCNFASRNDYSYWLSTPAL-----.MPMNMAPITGRALEPYISRCTVCEGP
CO4A1_CAEEL/1535-1644 GFTFAKHSQTTAVPQCPPGASQLWEGYSLLYVQG-NGRASGQDLGQPGSCLSKFNTMPFMFCNM.NSVCHVSSRNDYSFWLSTDEP-----.MTPMMNPVTGTAIRPYISRCAVCEVP
O09238_9METZ/629-736 GLLLVVHSQTTNIPQCPNDYTRLWVGYSLLQLTG-NGLGVGQDLGDPGSCMPSFHPMPVVRCNP.MQRCEFARRKDESYWLSTN-------.ATRPPIPVSGSDIEEHISRCSVCESN
O09238_9METZ/737-850 SISIAVHSQDSNVPDCFPGWVTLWTGFSFLQQTAAQAEGTGQGLESPGSCLQHFRSTPFIGCGG.RGQCSYDS-VSGSYWMIVLDALNPFQ.DTEPGTYPVS-DIEKRLSRCRVCEWV
Q26640_STRPU/1634-1746 TQSLAIHSQSQEIPQCPGGWRSLWTGYSFTMYTA-ASEGGGQGLESVGSCLENFRATPFIECNG.RGNCHFFS-NEYSFWLTVIDEEDQFA.IPRKRTIKSG-QLQSVVSRCRVCQKV
CO4A1_DROME/1659-1773 ANVIAVHSQTIEVPDCPNGWEGLWIGYSFLMHTAVGNGGGGQALQSPGSCLEDFRATPFIECNGaKGTCHFYE-TMTSFWMYNLESSQPFE.RPQQQTIKAG-ERQSHVSRCQVCMKN
Q07265_STRPU/1638-1751 AQVLTVHSQTVNIPDCPDRWGVLWIGYSFMMHTGPGGEGSGQMLSSPGSCLEDFRSSPFIECHG.DGKCNYYA-TTYTFWLSSITGNAQFT.MPQSETLKAG-SLRTRVSRCAVCLRN
CO4A3_HUMAN/1555-1668 AIAIAVHSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHG.RGTCNYYS-NSYSFWLASLNPERMFR.KPIPSTVKAG-ELEKIISRCQVCMKK
CO4A1_HUMAN/1555-1668 AMVMAVHSQTIQIPPCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHG.RGTCNYYA-NAYSFWLATIERSEMFK.KPTPSTLKAG-ELRTHVSRCQVCMRR
CO4A5_HUMAN/1571-1684 AVVIAVHSQTIQIPHCPQGWDSLWIGYSFMMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHG.RGTCNYYA-NSYSFWLATVDVSDMFS.KPQSETLKAG-DLRTRISRCQVCMKR
CO4A2_HUMAN/1597-1711 AIAIAVHSQDVSIPHCPAGWRSLWIGYSFLMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGgRGTCHYYA-NKYSFWLTTI-PEQSFQgSPSADTLKAG-LIRTHISRCQVCMKN
CO4A6_HUMAN/1575-1690 SQAIAVHSQDITIPQCPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGaRGTCHYFA-NKYSFWLTTVEERQQFGeLPVSETLKAG-QLHTRVSRCQVCMKS
CO4A2_CAEEL/1639-1753 ANTIAVHSQTIQIPNCPAGWSSLWIGYSFAMHTGAGAEGGGQSPSSPGSCLEDFRATPFIECNGaRGSCHYFA-NKFSFWLTTIDNDSEFK.VPESQTLKSG-NLRTRVSRCQVCVKS
CO4A4_HUMAN/1573-1689 AQAVAVHSQDQSIPPCPQTWRSLWIGYSFLMHTGAGDQGGGQALMSPGSCLEDFRAAPFLECQGrQGTCHFFA-NKYSFWLTTVKADLQFSsAPAPDTLKESQAQRQKISRCQVCVKY
CO4A1_CAEEL/1645-1758 TQIIAVHSQDTSVPQCPQGWSGMWTGYSFVMHTAAGAEGTGQSLQSPGSCLEEFRAVPFIECHG.RGTCNYYA-TNHGFWPSIVDQDKQFR.KPMSQTLKAG-GLKDRVSRCQVCLKN
O18407_DROME/1623-1735 TRIIALHSQSMSIPDCPGGWEEMWTGYSYFMSTLDNVGGVGQNLVSPGSCLEEFRAQPVIECHG.HGRCNYYD-ALASFWLTVIEEQDQFV.QPRQQTLKAD--FTSKISRCTVCRRR