EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01406 alignment
(11 sequences with 442 aa)


SYC_YEAST/49-475 FIPQSGNRGVTWYSCGPTVYDASHMGHARNYVSIDINRRIIQDYFGYDVQFVQNVTDIDDKIILRARQNYLFDNFVKENDT.KFNATVVDKVKTALFQYINKNFTIQGSEIKTIEEFETWLSNADTETLKLENPKFPMHVTAVQNAIESITKGDSMDAEVAFEKVKDVTVPLLDKELGSTISNPEIFRQLPAYWEQKFNDDMLSLNVLPPTVTTRVSEYVPEIIDFVQKIIDNGYAYATSDGSVYFDTLKFDKSPNHDYAKCQPWNKGQLDLINDGEGSLSNFADNGKKSNNDFALWKASKAGE...-PEWESPWGKGRPGWHIECSVMASDILG.....SNIDIHSGGIDLAFPHHDNELAQSEARFDNQQWINYFLHTGHLHI----EGQKMSKSLKNFITIQEALKKFSPRQLRLAF.ASVQWNNQLDFKESLIHEVKS
SYC_SCHPO/34-456 FVSNGSN--LTWYCCGPTVYDASHMGHARNYVTTDILRRILQSYFGYNITFVQNVTDIDDKIILRARQQYLFEEYKKQQGTnKSHSEAREKVTEAWFAYAKKNLPEPPSSMSEWPQWLASHDIPTLAINNPKLPMHVDALKSALDALQVSEASEIISLDGFWPKVQDVLVPLLDAELGSTVTDPAIFRKLAAYWEDDFNKDMANLNVLPPTAVTRVSEYVPEIVDFVQRIIDRGYAYPVTDGSVYFDTEAFEKG-GHFYAKLEPWNKGNRELIAEGEGSLA--ALTGKKRPGDFALWKASKPGE...-PSWDSPWSKGRPGWHIECSVMASALLG.....SNIDIHSGGIDLAFPHHDNELAQSEAYFDCPQWVNYFFHAGHLHI----EGQKMSKSLKNFITIKEILKKFTPRQLRLAF.LLQQWNTQLDFKETLLAYVLN
SYC1_MYCTU/19-315 DFVPLRPGHVSIYLCGATVQGLPHIGHVRSGVAFDILRRWLLA-RGYDVAFIRNVTDIEDKILAKAAAAGRP---------.--------------------------------------------------------------------------------------------------------WWEWAATHERAFTAAYDALDVLPPSAEPRATGHITQMIEMIERLIQAGHAYTGG------GDVYFDVLSYPEYGQLSGHKIDDVHQGEGVAAG--------KRDQRDFTLWKGEKPGE...-PSWPTPWGRGRPGWHLECSAMARSYLG.....PEFDIHCGGMDLVFPHHENEIAQSRAAGD--GFARYWLHNGWVTM----GGEKMSKSLGNVLSMPAMLQRVRPAELRYYL.GSAHYRSMLEFSETAMQDAVK
SYC_SYNY3/15-320 PLQPLHPGLVTMYCCGITVYDYCHLGHARTCITWDLVRRYLQW-SGYEVRYVQNFTDIDDKILKRAVDESST---------.--------------------------------------------------------------------------------------------------------MEAVSEKFIAAYFEDMEALGVQPADLYPRATHTLDGIKRLIAELEAKGYAYPSG------GDVYYSVRNFDGYGKLSGRRLEDLQAGASGRVTVADPDGAQKQDPFDFALWKSAKPGE...-PAWESPWGKGRPGWHIECSAMVREFLG.....ETIDLHVGGNDLIFPHHENEIAQSEAVTG-QPLAQYWLHNGMVKV----DGEKMSKSLGNFTTIRALLKTVDPMAIRLLV.LQGHYRKPLDFTETAIAAATN
SYC_BACSU/15-314 TFVPLEEGKVKMYVCGPTVYNYIHIGNARPAIVYDTVRNYLEY-KGYDVQYVSNFTDVDDKLIKAANELGED---------.--------------------------------------------------------------------------------------------------------VPTISERFIKAYFEDVGALGCRKADLHPRVMENMDAIIEFVDQLVKKGYAYESE------GDVYFKTRAFEGYGKLSQQSIDELRSGARIRV------GEKKEDALDFALWKAAKEGE...-ISWDSPWGKGRPGWHIECSAMVKKYLG.....DQIDIHAGGQDLTFPHHENEIAQSEALTG-KTFAKYWLHNGYINI----DNEKMSKSLGNFVLVHDIIKQHDPQLLRFFM.LSVHYRHPINYSEELLENTKS
SYC_HAEIN/14-314 IFKPIHENKVGMYVCGVTVYDLCHIGHGRTFVCFDVIARYLRS-LGYDLTYVRNITDVDDKIIKRALENKET---------.--------------------------------------------------------------------------------------------------------CDQLVDRMVQEMYKDFDALNVLRPDFEPRATHHIPEIIEIVEKLIKRGHAYVADN-----GDVMFDVESFKEYGKLSRQDLEQLQAGARIEIN------EIKKNPMDFVLWKMSKENE...-PSWASPWGAGRPGWHIECSAMNCKQLG.....EYFDIHGGGSDLMFPHHENEIAQSCCAHG-GQYVNYWIHSGMIMV----DKEKMSKSLGNFFTIRDVLNHYNAEAVRYFL.LTAHYRSQLNYSEENLNLAQG
SYC_ECOLI/14-314 EFKPIHAGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLRF-LGYKLKYVRNITDIDDKIIKRANENGES---------.--------------------------------------------------------------------------------------------------------FVAMVDRMIAEMHKDFDALNILRPDMEPRATHHIAEIIELTEQLIAKGHAYVADN-----GDVMFDVPTDPTYGVLSRQDLDQLQAGARVDVV------DDKRNPMDFVLWKMSKEGE...-PSWPSPWGAGRPGWHIECSAMNCKQLG.....NHFDIHGGGSDLMFPHHENEIAQSTCAHD-GQYVNYWMHSGMVMV----DREKMSKSLGNFFTVRDVLKYYDAETVRYFL.MSGHYRSQLNYSEENLKQARA
SYC_ARCFU/14-316 LEDIVDGKRVKMYVCGITAYDYSHIGHARSAVFFDVFRRYLEY-LGYEVVYVQNFTDVDDKIINRAVKEGKT---------.--------------------------------------------------------------------------------------------------------QKEVAEKFIEEYLKDMEALNVKKPTYQPKVTEHIPDIIEFIQNLIEKGYAYVID------GDVYFHVPAFEHYGELSKQSLEELNRHRIEPD-------ERKRDVKDFALWKSAKEADlkaQAVFDSPWGRGRPGWHIECSVMSAKYLG.....VPFDIHGGGKDLIFPHHENERAQSFARFG-VEPVKIWVHNDFIRI----KGEKMSKSLGNIVRIRDVLQRYEGEVLRYFL.LTAHYRSPLDYTEEALERAKR
SYC_HELPY/13-317 PFEPLVQNKANIYVCGPTVYDDAHLGHARSAIAFDLLRRTLEL-SGYEVMLVRNFTDIDDKIINKALKENKS---------.--------------------------------------------------------------------------------------------------------IQELSSIYIESYTRDLNALNVKKPSLEPKASEYLDAMVGMIETLLEKNIAYQVSN-----GDIYLDTSKDKDYGSLSVHNSS-IEFGRIGLVQ-------EKRLEQDFVLWKSYKGDN...DVGFDSPLGKGRPGWHIECSSMVFETLAltntpYQIDIHAGGADLLFPHHENEACQTRCAFG-VELAKYWMHNGFVNI----NNEKMSKSLGNSFFVKDALKNYDGEILRNYL.LGVHYRSVLNFNEEDLLVSKK
SYC_MYCPN/17-310 QSVVLEQKQINIYLCGPTVYNDLHLGNTRPLIVFDVLQRVLQA-AQYKVQFVQNITDIDDKIIKIAQQQEIS---------.--------------------------------------------------------------------------------------------------------EAQLCKQQITAYKSLLKKLNILP-IKHLQVTDKIDKMPGYIARLVKKGFAYVSPL-----GNTYFSVSQLPQYGILANRVVETIEDEATD-----------KRNKLDFVLWKQTTAG-...-VKWNSPWGWGRPGWHVECAFLIDYSFK.....DQLTIHGGGVDLKFPHHENENAMHMALYD-KPLTQHWMHIGHLMF----ENQKMSKSLQNFLLAVDFLTIHDFRILRWLF.YQKHYYHPLDLSQSLIEQACS
SYC_MYCGE/9-301 KPTTLVQKTINIYLCGPTVYNDLHLGNTRPLIVFDVLNRVLKK-AKYTVNFVQNITDIDDKIIKIAQQQEVS---------.--------------------------------------------------------------------------------------------------------ESVVTKQQITAYKSLLKKLNILP-IKHIQITEKIDKIPDYIDQLVNQNHAYVSTQ-----NNVYFAVNSLKQYGYLANRMVH-LEETDTD-----------KKNKLDFVLWKITTAG-...-IKWNSKWGLGRPGWHVECAFLIDYCFK.....NELTIHGGGVDLKFPHHENENALHMALYN-QPITKHWMHIGHLMI----ENQKMSKSLQNFLLAVDFLNFHDFRVLRWIF.YQKHYLHPIDLNQSLIEKANN