EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01396 alignment
(27 sequences with 43 aa)


YRDD_HAEIN/101-141 KITCPECKTGHLISRRGRQG.-KIFYGCDNFPKCKFSLPAKPY
YRDD_ECOLI/103-143 AITCPQCRTGHLVQRRSRYG.-KTFHSCDRYPECQFAINFKPI
TOP1_HELPY/660-698 GVKCPECG-GDIALKRSKKG.--SFYGCNNYPKCNFLSNHKPI
TOP1_BACSU/616-656 GVKCPSCGEGNIVERKSKKK.-RVFYGCDRYPDCEFVSWDKPI
YRDD_HAEIN/59-97 DEICPKCG-NLLQLKQGSFG.--MFIGCSHYPECDFVVREESE
YRDD_HAEIN/12-50 QEYCPQCG-APLQIKQGKKG.--LFLGCSAYPECDYLRPLQRS
TOP1_METJA/718-756 VGKCPKCG-GDLVVREGKFG.--KFVGCSNYPKCRYTEKLKLN
TOP1_METTH/677-715 VGKCPECG-SDLIKRSGRYG.--EFVGCKGFPKCRFTCSVDEV
TOP1_METJA/677-715 DRICPKCG-AKLILKKGVYG.--AFYGCSNYPKCKYTEPINKK
Q43888_STRAG/238-272 VGKCPKCG-NNIVLKKS---.---FYGCSNYPECKFTLAEHFR
Q60149_STRPY/630-664 VGKCPKCG-NNIVLKKS---.---FYGCSNYPECKFTLAEHFR
YRDD_ECOLI/61-99 GQVCPACG-ANLVLRQGRFG.--MFIGCINYPECEHTELIDKP
TOP1_BACAN/602-634 VCQCP-CG-NGIILDRG---.--KFFGCSNHPNCN--KGLPKR
TOP1_METJA/597-635 VGKCPKCGGDLILIRHKKG-.--RFVGCSNYPECDVKYSLPDK
TOP1_ARCFU/580-619 VGKCPECGGELVVRQSKAGK.--RFIGCSNYPDCTFTLPLPQN
TOP1_METTH/595-635 VGECPACG-GKLVIKYSPRN.RSTFVGCSSYPDCRTVYSLPRG
Y664_METJA/263-301 DNTCPWCG-AKLRVVRTKKG.--EFLGCTNYPNCLYRRFPKKN
TOP1_MYCPN/670-711 EELCPECN-SQLVKRRTKFNpNKTFVGCSNFPRCRYIKKDNAS
TOP1_MYCGE/664-705 DELCPECN-NKLVKRRTKFNaKKTFIGCSNFPNCRFIKKDNAA
TOP1_MYCPN/621-661 GRDCPSCA-SPLLYRYTKRG.NEKFVGCSNFPNCKYNEFSQNK
TOP1_MYCGE/615-655 ERDCPKCN-QPLVYRYTKRG.NEKFVGCSDFPKCKYSEFSNPK
TOP1_HELPY/613-651 QELCEKCG-GEMVQKFSRNG.--AFLACNNYPECKNTKSLKNT
TOP1_HELPY/569-607 GQSCPKCG-GELVKKNSRYG.--EFIACNNYPKCKYVKQTESA
TOP1_HAEIN/713-748 VVECDKCG-ADMHLKLGRFG.--KYMGCTN---CDNTRKILKN
TOP1_ECOLI/708-745 IVECEKCG-SEMHLKMGRFG.--KYMACTNE-ECKNTRKILRN
TOP1_BACSU/576-614 GEDCELCS-SPMVYKMGRYG.--KFLACSNFPDCRNTKPIVKQ
TP3A_HUMAN/655-694 IRKCPQCN-KDMVLKTKKNG.-GFYLSCMGFPECRSAVWLPDS