EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01394 alignment
(71 sequences with 44 aa)


Q7PQY9_ANOGA/253-288 PPEA-QSDFPVAMQVSPRYDVIYL---.---ITKYGYIHMYDIE
CLH_RAT/253-288 PPEA-QNDFPVAMQISEKHDVVFL---.---ITKYGYIHLYDLE
Q7SHV2_NEUCR/257-292 PPEA-SNDFPVALQVSQKYGIIYL---.---ITKYGFIHLYDLE
CLH_DICDI/251-287 PPEIGASDFPVAMQVSEKYEVIYM---.---VTKLGYIHLFDLG
CLH_SCHPO/251-286 PPEA-VNDFPIAIEIGSTYNVAYV---.---VTKYGFIHVYDLE
Q9C6U0_ARATH/76-111 PPDF-ADDFPVAMQVSHKFNLIYV---.---ITKLGLLFVYDLE
CLH_CAEEL/251-286 TADT-AGDFPVSMQVSAKQGIIYL---.---VTKQGYVHLYDVE
Q95Z06_9TRYP/254-290 DVPFAQGDFPVATHVSPRHKLLTV---.---VTSRGSVVLMDLF
Q8X1X8_PARBR/63-99 DVAFPPGDFPVALTVSPRHKLLTI---.---MTSRGTAILMDIF
CLH_SCHPO/19-56 GIQPSSFGFANVTLESDKYVCVRDN--.---PNGVNQVVIVDLE
Q95Z06_9TRYP/19-57 GLRPGTISFKTLTLQSDKYVCIRDVQ-.---PDGQTSLVIVDLG
Q9CA00_ARATH/20-56 GINQQFITFTNVTMESDKYICVRETS-.-----PQNSVVIIDMN
CLH_CAEEL/17-54 GIRVPNITFSNVTMESDKNIVVREMI-.---G-DQQQVVIIDLA
CLH_DROME/19-56 GINANSFSFSTLTMESDKFICVREKV-.---N-DTAQVVIIDMN
CLH_RAT/19-56 GINPANIGFSTLTMESDKFICIREKV-.---G-EQAQVVIIDMN
CLH_DICDI/18-56 GIGSNSIGFSTLTMESEKYICIRETT-.---PDDKNNVVIIDTD
CLH_YEAST/18-55 GISPQFLDFRSTTFESDHFVTVRET--.---KDGTNSVAIVDLA
Q7SHV2_NEUCR/19-58 GINQTAITFNTCTLESDNWVCIRDKK-.--DEAASPEVIIVDLK
Q7PQY9_ANOGA/198-234 AASFATFKMEENKELSTLFCFAVR---.---SQTAAKLHIIEVG
CLH_DROME/198-234 AASFATFKIDANKEPTTLFCFAVR---.---TATGGKLHIIEVG
CLH2_HUMAN/198-234 AAAFAEFKMEGNAKPATLFCFAVR---.---NPTGGKLHIIEVG
CLH_RAT/198-234 AASFAQFKMEGNAEESTLFCFAVR---.---GQAGGKLHIIEVG
CLH_CAEEL/196-232 AACFVRFKVDGNQNPSNLFCFSVK---.---TDNGGKLHVIEVG
Q39834_SOYBN/208-247 AASFAQFKVPGNENPSTLFLFATN-PN.--AGQIITKLHVIELG
Q9C6U0_ARATH/18-58 AASFAQFKVPGNENPSILISFASKSFN.--AGQITSKLHVIELG
Q7SHV2_NEUCR/203-239 AAAFGTLRLEGAPEDTKVFTFAVR---.---TAVGAKLHIVEVD
CLH_DICDI/198-234 AACFANYIVPGATRPSTLFAISSR---.---TQNASKILVLEVS
CLH_SCHPO/197-233 ASAFAVIQPEGVDHEVQVLALASR---.---LPTGSKLSIVEVD
CLH_SCHPO/60-94 NVLRRPISADSVILHPKKKIIALKAQ-.-------RQLQVFDLE
Q7SHV2_NEUCR/62-97 NVIRRPIKADSAIMHWTRQVIALKAQA.-------RTLQIFDLE
Q9CA00_ARATH/60-100 QPLRRPITADSALMNPNSKILALKAQV.--PGTTQDHLQIFNIE
CLH_CAEEL/58-92 NPTRRPISADSVIMHPTAKILALKS--.---GKT---LQIFNIE
CLH_RAT/60-94 NPIRRPISADSAIMNPASKVIALKA--.---GKT---LQIFNIE
Q8I5L6_PLAF7/59-99 NSTRKHMKAESVIIHPNDPILALKGTI.--KNMNTIFLQVFNIE
CLH_DICDI/60-94 QILRKQMKTDAAIMNPKEPILALK---.-----IGQVLQLISIE
Q95Z06_9TRYP/61-95 SMRNSIRDAESAIMNPMAKILALR---.-----SGRNLQIFDVD
CLH_YEAST/59-94 EVTRKNMGGDSAIMHPSQMVISVR---.----ANGTIVQIFNLE
Q39834_SOYBN/154-197 LPNNQIINYRCDPTEKWLVLIGILHGSpERPQLVKGRMQLFSVE
Q9CA00_ARATH/154-197 LANNQIINYKCSPNEKWLVLIGIAPGSpERQQLVKGNMQLFSVD
CLH_CAEEL/146-185 LAGTQIINYRADAENKWLVLIGIS---.AKDSRVVGSMQLYSTE
CLH_DROME/148-187 LNGCQIINYRCNASQQWLLLVGIS---.ALPSRVAGAMQLYSVE
CLH_RAT/148-187 LAGCQIINYRTDAKQKWLLLTGIS---.AQQNRVVGAMQLYSVD
Q7SHV2_NEUCR/153-192 LQGNQIINYRTSADGKWMVVVGIS---.QQQGRVVGAMQLYSKD
CLH_DICDI/148-187 LQNTEIINYRSDSTQNWLVLVAIH---.QRDGRVVGRIQLYSVE
CLH_SCHPO/147-186 LNGTQIISYKSNYNEEWFTLIGIS---.SRDNRIAGNLQLYSKK
CLH_YEAST/151-190 LNNTQIINFVANKNLDWFAVVGIL---.QENGRIAGRIQLFSKQ
Q8I5L6_PLAF7/183-224 DNNSQILYYSTDKDMKWCILCGISTQ-.DQGKSIDGYMQLYSCE
CLH_SCHPO/294-328 NRVSGESIFVTTAHKSVNGLMAIN---.-----RKGQVLSVSIN
CLH2_HUMAN/296-330 NRISADTIFVTAPHKPTSGIIGVN---.-----KKGQVLSVCVE
CLH_DROME/296-330 NRISADTIFVTAPHEASGGIIGVN---.-----RKGQVLSVTVD
Q8UUQ9_CHICK/31-65 NRISGETIFVTAQHEATAGIIGVN---.-----RKGQVLSVCVE
CLH_DICDI/295-329 NRISNENIFVTAFEESTNGIIAVN---.-----RKGQVLSVSID
CLH_CAEEL/294-328 NRISTDTVFVTCEYTATGGIMGIN---.-----RKGQVLSVSID
Q7SHV2_NEUCR/300-334 NRISSDTIFTACGDKDSTGVIGIN---.-----RKGQVLFVSAD
Q9C6U0_ARATH/119-153 NRISPDPIFLTSEASSVGGFYAIN---.-----RRGQVLLATVN
CLH_YEAST/302-336 NRITAESVFTAAPYNHENGIACIN---.-----KKGQVLAVEIS
Q7RNG3_PLAYO/314-348 EKISDDNIFICCDNKNGEGIIAVN---.-----KKGKIYYITLN
Q95Z06_9TRYP/298-332 HQLPNNTIFCGTPYTKTGGILCVN---.-----NAGSVFHVSPN
Q8X1X8_PARBR/107-141 QQVTSNIVFCGTLYTKTGGLLCVN---.-----NQGSVFHVSPN
CLH_SCHPO/102-133 YVMNQDVVYWT-----WISDSVIG---.---MVTDTSVFHWTVS
Q95Z06_9TRYP/103-134 VVFNEDVVYWC-----WIDARTVG---.---IVSNTAVYHWSLD
Q9CA00_ARATH/108-139 HQMPEQVVFWK-----WITPKMLG---.---LVTQNSVYHWSIE
CLH2_HUMAN/102-133 HTMAEEVIFWK-----WVSVNTVA---.---LVTETAVYHWSME
CLH_DROME/102-133 HTMNEDVVFWK-----WISLNTLA---.---LVTETSVFHWSME
CLH_RAT/102-133 HTMTDDVTFWK-----WISLNTVA---.---LVTDNAVYHWSME
CLH_CAEEL/100-131 HQNVEDVVYWK-----WISEKTIA---.---LVSDTAVYHWSIE
CLH_DICDI/102-133 CQMQEPLEFWK-----WISPNTLA---.---LVTATSVFHWTKE
Q7SHV2_NEUCR/105-136 TNMSEDVLFWK-----WVSETTLG---.---LITDGSVYHWDVF
Q8I5L6_PLAF7/107-138 LNLNEYMNYWK-----WINNDTIA---.---IVCEKNVYHWNID
Q95Z06_9TRYP/203-234 GTFISTNTPTD-----PRSCNLMC---.---LAWNNPSTGGKIL
Q8X1X8_PARBR/12-43 GTFISTNTPTE-----PRACNIMC---.---LAWNTPHEGGKVQ