EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01371 alignment
(18 sequences with 88 aa)


TRPR_XYLFA/5-90 QAFEMLIKILCKTDSTDDMKLILECILTRSEMEDLIDRIRIYNELLNTNNSQREVASKLGVSITKITRGAANLQ--DNNIKDFLRKKI
Q8EBT0_SHEON/3-90 ANWDLVLEKILSHGNYEELSVLFHLLLTEEERSAIAGRLKVFQLLLNGEMSQRQIAAEYQVSIATITRCSNYLKNMAPSHRDKIQQLI
Q8KQD4_CHLTR/7-94 SGWQAFLTLCSKMQKEKFLQDLFSLFLSFSERKDVASRYHIIRALLEGELTQREIAEKYGVSIAQITRGSNALKGLDPQFKEFLPKEI
TRPR_HAEIN/8-95 EQWNAFLQMLKIAFEENKAQEFLTLLLTADERDAVGLRLQIVSQLIDKNMPQREIQQNLNTSAATITRGSNMIKTMDPDFMQWMKQHL
TRPR_PASMU/8-95 EQWHAFVEMLRTAFAQGKEQEILTLLLTPDERDSVGLRLQIVAQLLDKSVPQREIQQNLNTSAATITRGSNMIKTMPPEFMAWVKEQL
TRPR_VIBPA/8-95 RDWQQIVELIRSSVDSQQHEMLLTMLMTPDERESLTARVNILNELLKGELSQRQISQMLGVGIATITRGSNELKSKSEAEKDKLKLLL
TRPR_VIBVU/8-95 TDWQQIVDLVKHSVEQKQHDMLLTMLMTPDEREALVSRVNIVRELLKGELSQRQISQMLGVGIATITRGSNELKLKSDEDKARLNQLL
TRPR_YERPE/33-120 QHWLSFVALLQNAITQDLHLPLLQLMLTPDERTALGTRVRIIEELMRGELSQRELKSQLGAGIATITRGSNSLKTAPPQLKSWLEAQL
TRPR_ENTCL/17-104 QEWLRFVELLRQSYDKDLHLPLLQLMLTPDEREALGTRVRIIEELLRGEMSQRELKNELGAGIATITRGSNSLKSAPVELRQWLEQIL
Q87C27_XYLFT/15-101 AALQALADALACLRNSATVLAFLRDLCTPAELEALADRWRVVP-LLLQGRPYRDIHDHTGISVTTIGRVARCLEHGTGGYAAVLQAQA
Q8P9P4_XANCP/15-101 ASLKMLSEALACLEAPGAVEAFLRDLCTPAELEAMSDRWRVVP-LLVKGVPYREIHDLTQVSVTTIGRVARTLEHGAGGYAAALREQS
Q8RC44_THETN/9-95 KLVDQLFEAILKLKNIEECYRFFEDIATINEIKALAQRLEVAR-MLRQKKTYIEIAEKTGASTATISRVNRALNYGANGYKIILERLE
Q8XHZ0_CLOPE/11-97 KDLDFLFEAILKLEDINECYNFFEDICTISELKALAQRLHVAK-MLREKKTYTEIAEETKASTATISRVNRCLNYGADGYNNILNRLD
Q97FQ3_CLOAB/11-97 ETLDFLCDAILTLENREECYRFFDDIFTINEIKTIEQRLQVAK-MLKEKHTYSDISAETGASTATISRVNRCINYGSDGYNIVLRRLE
Q8ES89_OCEIH/9-95 EQLDLLFDAILSLKDKEECYKFFDDIATMSEVQSLSQRFQVAK-MLTEGNTYSAIEKETKASTATISRVRRCINYGSDGYNLVLERMN
Q92AP5_LISMO/9-95 QGLDEFFQGILTLENLEECYAFFDDVCTVNEIQSMAQRFQVAK-MLHDGKTYNVIESETGASTATISRVKRSLHYGNDMYDVVFSRMT
Q8CRT7_STAEP/9-95 QSLDELFDAILALENREECYQFFDDLCTVNEIQSLSQRLQVAK-MIKQGYTYATIEEESGASTATISRVKRSLQWGNDAYTMILDRLN
Q7BVT7_BACSU/9-95 KELDQLFNSILSLKDLEECYRFFDDLCTINEIQSLAQRLEVAR-MLREGNTYHKIETETGASTATISRVKRCLNYGNDAYEMALDRVK