EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01325 alignment
(10 sequences with 62 aa)


MNTR_BACSU/1-61 MTTPSMEDYIEQIYMLIE-EKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLV
O30276_ARCFU/1-61 MLGSRAEDYLEAIYSLSK-EKGYAKVMELSEVLNVKPATVSEMLEKLSRMGYVEYKKRSHVK
O28489_ARCFU/1-60 --MERIEEYLEAIYDIQEETSKVAKTGELAKILNVKPSSVTEMLIKLRDMGYVDYQPYKGAK
O27019_METTH/11-70 ELTRSMENYLETLYRLS--SHGIVKTSDLSSRMNVRPASVTQMLKRLHEMGLVIYHPYLGAE
O26316_METTH/6-66 HLSENIEEYLETIYRLSD-SRKPVTTTDISREMKIAPASVTQMLKKLDSNGYVKYSPYRGAV
P72424_STAEP/1-61 MLTEEKEDYLKAILTNDG-DVSFVSNKKLSQFLNIKPPSVSEMVGRLEKEGYVETKHYKGAR
O33330_MYCTU/9-70 DLSAVAQDYLKVIWTAQEWSQDKVSTKMLAERIGVSASTASESIRKLAEQGLVDHEKYGAVT
Q50379_MYCSM/3-63 DLVDTTEMYLRTIYDLEE-EGVVPLRARIAERLDQSGPTVSQTVSRMERDGLLHVAGDRHLE
DTXR_CORDI/3-63 DLVDTTEMYLRTIYELEE-EGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQ
O28295_ARCFU/7-68 KFVTKTEVVLRTVYTALEKGLAVIGPTQVAEELGVSKSTAQKMLNELSKAGYGVYVPKKGLV