EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01321 alignment
(2 sequences with 164 aa)


CREA_BACB0/1-163 QQITDLERTKILQNGGEKVKPTFSKEEMTRRNTRLREYMAKAGIDAVMFTSYHNINYYSDFLYTSFNRSYALVVTQDKHVTVSANIDAGMPWRRSF-DENIVYTDWKRDNFLYAVKKVLNEGGFSSGRLGVENDHMTLDLRRQVQDALPNTELVDVSQAVMGHR
CREA_FLASU/1-156 MQMPKTLR---IRNG-EKVKSTFSAQEYANRHAKLRAHLAAENIDAAVFTSYHNINYYSDFLYCSFGRPYALVVTQDDVISISANIDGGQPWRRTVGTDNIVYTDWQRDNYFVAIQQALPR----ARRIGIEHDHLNLQNRDKLAARYPDAELVDVAAACMRMR