EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01294 alignment
(6 sequences with 180 aa)


RL13_TOBAC/1-179 MYSANGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKISPRPTAGTLRPIVHGQTLKYNMKVRSGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLEDLQGQLVVFPRRASRSRLVILPPRNCLTATQVHGAYMPIER-EKHQLILSKVLKKMKSFNAYAKLRVE
RL131_BRANA/5-183 NVIPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVHGQTLKYNMKVRTGKGFTLEELKSAGIPKKLAPTIGIAVDHRRKNRSLEGLQSNVQRLKTYKAKLVIFPRRARKVKAGDSTAEELANATQVQGDYMPIVR-EKHATELVKLTTEMKSVKAFDKIRLE
RL13_SCHMA/6-184 DVLHHNHFRKKWQFMVKTWFNQPARKERRRQARKAKAQRIAPRPASGPLRPIVNCPTFRYNMKVRSGRGFSLQEVRAAGLNPKFARTIGIAVDHRRRNVSVEGLQRNVARLKAYKAKLILFPLNPAKPQAMDAKADEVKKATQLRRPVLPITQ-RAKRLKAHKPTSSELRYSAFHAIRQQ
RL13_DROME/6-185 NMIPNQHYHKWWQRHVKTWFNQPARKVRRHANRVKKAKAVFPRPASGALRPVVRCPTIRYHTKLRAGRGFTLEELKGAGIGANFAKTIGIAVDRRRKNKSLESRQRNIQRLKEYRSKLILFPINEKKIRAGESSLEECKLATQLKGPVLPIKNEQPAVVEFREVTKDEKKFKAFATLRKA
RL13_CHICK/6-184 GMILKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPVAGPIRPIVRCPTVRYHKKVRAGRGFSLEELKLAGINKRFARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPKKGDSSPEELKMATQLSGPVMPIRN-VFKREKARVISEEEKNFKAFASLRMA
RL13B_YEAST/7-173 LPILKNHFRKHWQERVKVHFDQAGKKVSRRNARAARAAKIAPRPLD-LLRPVVRAPTVKYNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRRQNRNQEIFDANVQRLKEYQSKIIVFPRDGKAP-----EAEQVLSAAAT----FPIAQ-PATDVEARAVQDNGE--SAFRTLRLA