EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01289 alignment
(6 sequences with 468 aa)


TACY_STRPY/105-570 HTEEINDKIYSLNYNELEVLAKNGETIENFVPKEGVKKADKFIVIERKKKNINTTPVDISIIDSVTDRTYPAALQLANKGFTENKPDAVVTKRNPQKIHIDLPGMGD-KATVEVNDPTYANVSTAIDNLVNQWHDNYSGGN-TLPARTQYTESMVYSKSQIEAALNVNSKILDGTLGIDFKSISKGEKKVMIAAYKQIFYTVSANLPNNPADVFDKSVTFKELQRKGVSNEAPPLFVSNVAYGRTVFVKLETSSKSNDVEAAFSAALKGTDVKTNGKYSDILENSSFTAVVLGGDAAEHNKVVTKDFDVIRNVIKDNATFSRKNPAYPISYTSVFLKNNKIAGVNNRTEYVETTSTEYTSGKINLSHQGAYVAQYEILWDEINYDDKGKEVITKRRWDNNWYSKTSPFSTVIPLGANSRNIRIMARECTGLAWEWWRKVIDERDVKLSKEINVNISGSTLSPYGSITY
TACY_PAEAL/37-501 PND-IDMGIAGLNYNRNEVLAIQGDQISSFVPKEGIQSNGKFIVVERDKKSLTTSPVDISIVDSITNRTYPGAIQLANKDFADNQPSLVMAARKPLDISIDLPGLKN-ENTISVQNPNYGTVSSAIDQLVSTWGEKYSSTH-TLPARLQYAESMVYSQNQISSALNVNAKVLNGTLGIDFNAVANGEKKVMVAAYKQIFYTVSAGLPNNPSDLFDDSVTFAELARKGVSNEAPPLMVSNVAYGRTIYVKLETTSKSNDVQTAFKLLLNNPSIQASGQYKDIYENSSFTAVVLGGDAQTHNQVVTKDFNVIQSVIKDNAQFSSKNPAYPISYTSVFLKDNSIAAVHNNTEYIETKTTEYSKGKIKLDHSGAYVAQFEVYWDEFSYDADGQEIVTRKSWDGNWRDRSAHFSTEIPLPPNAKNIRIFARECTGLAWEWWRTVVDEYNVPLASDINVSIWGTTLYPKSSITH
TACY_CLOPE/34-499 KNQSIDSGISSLSYNRNEVLASNGDKIESFVPKEGKKTGNKFIVVERQKRSLTTSPVDISIIDSVNDRTYPGALQLADKAFVENRPTILMVKRKPININIDLPGLKG-ENSIKVDDPTYGKVSGAIDELVSKWNEKYSSTH-TLPARTQYSESMVYSKSQISSALNVNAKVLENSLGVDFNAVANNEKKVMILAYKQIFYTVSADLPKNPSDLFDDSVTFNDLKQKGVSNEAPPLMVSNVAYGRTIYVKLETTSSSKDVQAAFKALIKNTDIKNSQQYKDIYENSSFTAVVLGGDAQEHNKVVTKDFDEIRKVIKDNATFSTKNPAYPISYTSVFLKDNSVAAVHNKTDYIETTSTEYSKGKINLDHSGAYVAQFEVAWDEVSYDKEGNEVLTHKTWDGNYQDKTAHYSTVIPLEANARNIRIKARECTGLAWEWWRDVISEYDVPLTNNINVSIWGTTLYPGSSITY
TACY_LISMO/57-524 HADEIDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIVVEKKKKSINQNNADIQVVNAISSLTYPGALVKANSELVENQPDVLPVKRDSLTLSIDLPGMTNQDNKIVVKNATKSNVNNAVNTLVERWNEKYAQAYPNVSAKIDYDDEMAYSESQLIAKFGTAFKAVNNSLNVNFGAISEGKMQEEVISFKQIYYNVNVNEPTRPSRFFGKAVTKEQLQALGVNAENPPAYISSVAYGRQVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKNSSFKAVIYGGSAKDEVQIIDGNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAVIKNNSEYIETTSKAYTDGKINIDHSGGYVAQFNISWDEVNYDPEGNEIVQHKNWSENNKSKLAHFTSSIYLPGNARNINVYAKECTGLAWEWWRTVIDDRNLPLVKNRNISIWGTTLYPKYSNKV
TACY_LISIV/56-523 NAAQIDQYIQGLDYDKNNILVYDGEAVKNVPPKAGYKEGNQYIVVEKKKKSINQNNADIQVINSLASLTYPGALVKANSELVENQPDVLPVKRDSVTLSIDLPGMVNHDNEIVVQNATKSNINDGVNTLVDRWNNKYSEEYPNISAKIDYDQEMAYSESQLVAKFGAAFKAVNNSLNVNFGAISEGKVQEEVINFKQIYYTVNVNEPTSPSRFFGKSVTKENLQALGVNAENPPAYISSVAYGRDIFVKLSTSSHSTRVKAAFDTAFKGKSVKGDTELENIIQNASFKAVIYGGSAKDEVEIIDGDLSKLRDILKQGANFDKKNPGVPIAYTTNFLKDNQLAVVKNNSEYIETTSKAYSDGKINLDHSGAYVARFNVTWDEVSYDANGNEVVEHKKWSENDKDKLAHFTTSIYLPGNARNINIHAKECTGLAWEWWRTVVDDRNLPLVKNRNVCIWGTTLYPAYSDTV
TACY_STRPN/1-467 ANKAVNDFILAMNYDKKKLLTHQGESIENRFIKEGNQLPDEFVVIERKKRSLSTNTSDISVTATNDSRLYPGALLVVDETLLENNPTLLAVDRAPMTYSIDLPGLASSDSFLQVEDPSNSSVRGAVNDLLAKWHQDYGQVN-NVPARMQYEKITAHSMEQLKVKFGSDFEKTGNSLDIDFNSVHSGEKQIQIVNFKQIYYTVSVDAVKNPGDVFQDTVTVEDLKQRGISAERPLVYISSVAYGRQVYLKLETTSKSDEVEAAFEALIKGVKVAPQTEWKQILDNTEVKAVILGGDPSSGARVVTGKVDMVEDLIQEGSRFTADHPGLPISYTTSFLRDNVVATFQNSTDYVETKVTAYRNGDLLLDHSGAYVAQYYITWNELSYDHQGKEVLTPKAWDRNGQDLTAHFTTSIPLKGNVRNLSVKIRECTGLAWEWWRTVYEKTDLPLVRKRTISIWGTTLYPQVEDKV