EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01287 alignment
(8 sequences with 72 aa)


IF5A_SULAC/69-131 IIEKHVGQILADK-GDNLTIMDL---ESYETFDLEKPT--ENEIVSKIRPGA---EIEYWSVMGRRKIVRVK
IF5A_METJA/70-129 IIDRRKGQVLAIM-GDMVQIMDL---QTYETLELPIPE----GIEGLEPGGE----VEYIEAVGQYKITRVI
IF5A_NEUCR/90-157 NVKRTDYQFSYID-EDFLVLIDS-NGEEKRELKMPEGE-LAKRIEKLEEEGK-DFFVGVQTAMGEEAAIDVK
IF5A_DICDI/98-165 NVSRKEYTVMDVQ-DGYLSLLDA-GGEVKEDLALPEDD-IGKEITQMLKEGK-EPLVSVISALGKEGVVSVK
IF5A1_YEAST/83-150 FVKRSEYQLLDID-DGYLSLMTM-DGETKDDVKAPEGE-LGDSMQAAFDEGK-DLMVTIISAMGEEAAISFK
IF5A1_TOBAC/85-154 HVNRTDYQLIDISEDGFVSLLTE-NGNTKDDLRLPTDDNLLALIKDGFAEGK-DLVLSVMSAMGEEQICGIK
IF5A1_CHICK/83-150 NIKRNDYQLIGIQ-DGYLSLLTE-SGEVREDLKLPEGD-LGKEIEGKFNANE-DVQISVISAMNEECAVAIK
IF5A1_CAEEL/87-156 VVKRREYILMSIE-DGFCSLMDPESCELKDDLKMPEGD-LGNTIREALEKDEGSVLVQVVAACGEEAILGYK