EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01272 alignment
(8 sequences with 81 aa)


GREB_HAEIN/81-156 KQEG-KVFFGAWVELENEEGETK-QYRIVGCDE--FAPAKNWISIDSPVARALIGKTLDDEVRVETPSG-FITLYVNKIWY
GREB_ECOLI/80-155 QQEG-KVFFGAWVEIENDDGVTH-RFRIVGYDE--IFGRKDYISIDSPMARALLKKEVGDLAVVNTPAG-EASWYVNAIEY
GREA_RICPR/81-157 LSGD-NIKFGATVTLIDDDTEEEVTYIIVGEYE--ADITKKRVSIASPIAKALIGKSVGDFVEVTTPKG-LKSYEVVTVEY
GREA_HELPY/80-156 LAHN-KVSFGSTIKILNLDNDKEFSYTIVGSVE--SDPAKGLISFGSPIAKSLIGKSKGDAVSIQLPNG-ESDFEILDIYY
GREA_HAEIN/80-157 MPNNGKVIFGATVVLVNTNTDEEVTYRIVGDDE--ADIKSGLISVNSPIARGLIGKELDDTVNITTPGG-VVEFDIIEVNY
GREA_ECOLI/80-157 MPNNGRVIFGATVTVLNLDSDEEQTYRIVGDDE--ADFKQNLISVNSPIARGLIGKEEDDVVVIKTPGG-EVEFEVIKVEY
GREA_MYCGE/83-160 KTKVTKVSLGSTVEIYDYSSKSNEKYTIVGTLE--ANPEEHKISNESPLALAIYGRLIGDECDVVGIEV-PYRVKILKISN
GREA_MYCLE/81-161 KQSGVALPGSVVKVYYNDDKSDTETFLIATRQEGVNEGKLEVYSPNSPLGGALIDAKVGETRSYTVPNGNTVQVTLISAEP