EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01246 alignment
(7 sequences with 71 aa)


RLP24_SCHPO/1-71 MRVHTCYFCSGPVYPGHGIMFVRNDSKVFRFCRSKCHKNFKMKRNPRKVAWTKAYRKAHGKEMVYDTALAV
RL24_KLULA/1-71 MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQSSKSASLFHQRKNPRRIAWTVLYRRHHKKGITEEVARKR
RL24_RAT/1-71 MKVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHKKGQSEEIQKKR
RL24_HORVU/3-73 LKTELCRFSGQKIYPGKGIRFIRSDSQVFLFANSKCKRYFHNRLKPAKLCWTAMYRKQHKKDIHAEAAKKR
RL24_ARATH/3-73 LKTELCRFSGQKIYPGRGIRFIRSDSQVFLFLNSKCKRYFHNKLKPSKLAWTAMYRKQHKKDAAQEAVKRR
RL24E_METJA/2-70 PEWRTCSFCGYEIEPGKGKMVVEKDGTVLYFCSSKCEKSYRMGRNPRKLKWTKVY--QDMKAELKKAQESQ
RL24E_HALMA/1-66 PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDT-----ARGEAGEAEDEA