EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01232 alignment
(16 sequences with 172 aa)


MTLD_BACST/1-124 MLAVHFGAGNIGRG----FIGSLLSQ-SGYEVVFVDINDELVRL-.----LKEKQEYRVIIAD--....-ENRQELLIRNVSAVNSQTER--EKVIDYITK--AHLITTAVGP-------------HILPAIATILAEG-------------LQKRITINKTPLHIIACENM
MTLD_BACSU/1-122 MIALHFGAGNIGRG----FIGALLHH-SGYDVVFADVNETMVSL-.----LNEKKEYTVELAE--....-EGRSSEIIGPVSAINSGSQT--EELYRLMNE--AALITTAVGP-------------NVLKLIAPSIAEG-------------LRRRNTAN--TLNIIACENM
MTLD_STRMU/2-126 KKAVHFGAGNIGRG----FIGQILFE-NGFAIDFVDVNDKIINA-.----LNERHSYDIEIAE--....-DGKRHITVSNVAGINNKENP--QAVIDAVAE--TELITTAIGP-------------NILPFIAQLIAKGI------------EKRRESQNQTPLDIIACENM
MTLD_ENTFA/1-125 MNAVHFGAGNIGRG----FIGEILAK-NGFHITFVDVNETIIQA-.----LKERKSYTIELAD--....-ASHQQINVENVTGLNNMTEP--EKVVEAIAE--ADLVTTAIGP-------------NILPRIAELIAQGI------------DARAEANCQKPLDIIACENM
MTLD_ECOLI/1-123 MKALHFGAGNIGRG----FIGKLLAD-AGIQLTFADVNQVVLDA-.----LNARHSYQVHVVG--....-ETEQVDTVSGVNAVSSIG----DDVVDLIAQ--VDLVTTAVGP-------------VVLERIAPAIAKGQ------------VKRKEQGNESPLNIIACENM
MTLD_CLOAB/1-123 MKALHFGAGNIGRG----FIGYLLYK-SNYETTFVDIFDKVVDD-.----INKYKRYTVITLS--....-TSKNKEKVENVRAVNLKDS---VALEKEVLE--ADLITTSLGL-------------NNLKSTGELLRGF-------------LKKRSEINDKPLDIIACENA
MTLD_MYCPN/4-118 INVLHFGAGNIGRG----VILPIYQQ-NDFSIDLVELNQNTVNE-.----LQKQKQYQVHYLD--....--CDQSQLVNDFNTWNLKDEA---KIIELMER--ADVISTSIGA-------------KNLASLKTLFDKA--------------------KFHKRAIVLCFEN
YDFI_ECOLI/22-185 PRIVHLGFGAFHRAHQGVYADILATE-HFSDWGYYEVNLIGGEQ-.QIADLQQQDNLYTVAEM-S....ADVWTARVVGVVKKALHVQIDGLETVLAAMCEPQIAIVSLTITEKGYFHSPATGQLMLDHPMVAADVQNPHQPKTATGVIVEALARRKAAGLPAFTVMSCDNM
UXUB_ECOLI/23-188 SRIVHLGCGAFHRAHQALYTHHLLES-TDSDWGICEVNLMPGNDRvLIENLKKQQLLYTVAEK-G....AESTELKIIGSMKEALHPEIDGCEGILNAMARPQTAIVSLTVTEKGYCADAASGQLDLNNPLIKHDLENPTAPKSAIGYIVEALRLRREKGLKAFTVMSCDNV
YEIQ_ECOLI/25-188 SRIVHFGFGAFHRAHQALLTDRVLNA-QGGDWGICEISLFSGDQ-.LMSQLRAQNHLYTVLEK-G....ADGNQVIIVGAVHECLNAKLDSLAAIIEKFCEPQVAIVSLTITEKGYCIDPATGALDTSNPRIIHDLQTPEEPHSAPGILVEALKRRRERGLTPFTVLSCDNI
YEI0_YEAST/36-200 QGIVHLGVGAFHRSHLAVFMHRLMQEHHLKDWSICGVGLMKADAL.MRDAMKAQDCLYTLVER-G....IKDTNAYIVGSITAYMYAPDD-PRAVIEKMANPDTHIVSLTVTENGYYHSEATNSLMTDAPEIINDLNHPEKPDTLYGYLYEALLLRYKRGLTPFTIMSCDNM
MTLK_RHOSH/16-179 PGIVHIGVGNFHRAHQAVYLDDLFALGEGHDWAILGAGVRPTDAR.MREALAAQDNLSTVIEL-D....PAGHRARQVGAMVGFLPVEAD-NAALIEAMSDPRIRIVSLTVTEGGYYVDAS-GAFDPTHPDIVADAAHPARPATAFGAILAALRARRDAGVTPFTVMSCDNL
O68111_RHOCA/17-181 PGIVHIGLGNFHRAHQAVYLDDLFGLGEGHDWALIGAGVRAPDAA.MREVLLAQDGLSSVIEL-A....PGAHSARVIGAMIDFVAVQPG-NAALIATMARPEIRIVSLTVTEGGYYIDPNTGTFSPDHPDIQADAARPDAPDTAFGAIIAALKMRRAAGVAPFTVMCCDNV
O08355_PSEFL/27-192 QGIAHIGVGGFHRAHQAYYTDALMNTGEGLDWSICGVGLRSEDRK.ARDDLAGQDYLFTLYELGD....TDDTEVRVIGSISDMLLAEDS-AQALIDKLASPEIRIVSLTITEGGYCIDDSNGEFMAHLPQIQHDLAHPSSPKTVFGFICAALTQRRAAGIPAFTVMSCDNL
DALD_KLEPN/5-166 FTWLHIGLGSFHRAHQAWYLHRLIAS-GDNRWRIAAGNIRNDAEQ.VVQALAAQGGRYVLETVSP....EGEREYEEITSIQKLLPWQAG-LQPLINEGANPQTKVIAFTVTEGGYYLN-TRHRLETSNPDLQADLQGECK--TIYGTLARILEKRMADNAGPLTLLNCDNV
UXAB_ECOLI/16-173 ERIIQFGEGNFLRAFVD-WQIDLLNEHTDLNSGVVVVRPIETSFP.--PSLSTQDGLYTTIIRGLnekgEAVSDARLIRSVNREISVYSEY-DEFLKLAHNPEMRFVFSNTTEAG--ISYHAGDKFDDAPAVSYPAKLTR-------LLFERFSHFNGALDKGWIIIPCELI