EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01227 alignment
(15 sequences with 107 aa)


GCH1_HAEIN/96-200 EMVQVNDITLTSTCEHHFVTIDGKVCVAYYP.KD.WVIGLSKINRIVSFFAQRPQVQERLTEQLLTAFQTILETDDVAVYVKATHFCVKARGIRDTNSYTVTSAYGG
GCH1_ECOLI/97-201 EMVTVRDITLTSTCEHHFVTIDGKATVAYIP.KD.SVIGLSKINRIVQFFAQRPQVQERLTQQILIALQTLLGTNNVAVSIDAVHYCVKARGIRDATSATTTTSLGG
GCH1_STRPN/62-166 NMVVEKDIFFHTMCEHHFLPFYGRAHIAYIP.DG.RVAGLSKLARTVEVYSKKPQIQERLNIEVADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARG
GCH1_YEAST/119-223 EMVIVRDIEIYSLCEHHLVPFFGKVHIGYIP.NK.KVIGLSKLARLAEMYARRLQVQERLTKQIAMALSDILKPLGVAVVMEASHMCMVSRGIQKTGSSTVTSCMLG
GCH1_CAEEL/100-204 EMVIVKDIEMFSLCEHHLVPFMGKVHIGYIP.NK.KVLGLSKLARIVEMFSRRLQVQERLTKQIATAMVQAVQPSGVAVVIEASHMCMVMRGVQKINASTTTSCMLG
GCH1_BACSU/65-170 ELVLVKDIAFHSMCEHHLVPFYGKAHVAYIPrGG.KVTGLSKLARAVEAVAKRPQLQERITSTIAESIVETLDPHGVMVVVEAEHMCMTMRGVRKPGAKTVTSAVRG
Q9YBX9_AERPE/44-139 LHIVLET-AVDAVCPFTGAPDSYDVEIEYVS.RD.ACLEALSLASWLESFRGVKISQEQLAHEIALTLKELLKPEYVCVKLTGSH------G--RVGMVVERCEDTS
Q9WZP8_THEMA/32-126 EYIKIETDEFSAVCPFSGLPDIGRVIIEYYP.DGgKIVELKSLKYYFVSFRNVGIYQEEATKRIYEDLKNLLKTDRIRVTVIYN-----IRGGIK------TTTQMG
Q55978_SYNY3/37-136 YDVHITLPEFTCKCPFSGYPDFATLYLTYCP.DQ.KVVELKSIKLYINSYRDRHIPHEEVTNQILDDFVAVANPLYARLKADFNP-----RGNVHTVIEVEYHQEKA
Q9PLV4_CAMJE/27-126 YIIKITLPEFMCCCPRSGYPDFATIYLEYMP.DK.FVVELKAIKLYINTFMYRNVSHEASINEIYNTLKDKLKPKWIKVVGDFNP-----RGNVHTVIECRSDMVVP
O67073_AQUAE/30-129 YMIEITFPEFTCLCPRSGYPDFATIKIRYIP.DK.YIVELKSLKLWLNKFRNRYISHEAATNEIYQALYDLLKPRFLEVVGDFHP-----RGNVHTVVRVRSDENYG
Q9A515_CAUCR/36-135 YLARFVAPEFTSLCPVTGQPDFAHLVIDYAP.GD.WLIESKSLKLYLTSFRNHGSFHEDCTVKVARKIVEIAQPRWLRIGGYWYP-----RGGIPIDVFWQTGPAPE
Q983K4_RHILO/38-137 AIVRFTCPEFTSLCPVTGQPDFAHIVIDYAP.DA.ALVESKSLKLFMTSFRNHGAFHEDCTVMIGRRIVAATKPLWLRIGGYWYP-----RGGIPIDVFWQTGAPPE
Q9ZJJ9_HELPJ/37-134 PLITLECKEFTSLCPITSQPDFGVIFIRYIP.KD.KMVESKSLKLYLFSYRNHGSFHESCINTILLDLVQLLEPKYLEVYGDF-----VSRGGIAIKPFVNYAIK--
O31678_BACSU/43-142 YFVKFNCPEFTSLCPKTGQPDFATIYISYIP.DE.KMVESKSLKLYLFSFRNHGDFHEDCMNIIMNDLIELMDPRYIEVWGKFTP-----RGGISIDPYTNYGKPGT