EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01215 alignment
(4 sequences with 99 aa)


COX5B_BOVIN/1-97 ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATS-GTKEDPNLVPSITNKRIVGCICEEDNS-TVIWFWLHKGEAQRCPSCGTHYKLVPHQLA
COX4_YEAST/51-149 AKEGTVPTDLDQETGLARLELLGKLEGIDVFDTKPLDSSRKGTMKDPIIIESYDDYRYVGCTGSPAGSHTIMWLKPTVNEVARCWECGSVYKLNPVGVP
COX4_SCHPO/60-158 GRDGEVPTDLEQATGLERYELLSELSGRDAFDMKPLDASRKGTLTDPIMVTSLDPYRHIGCTGSPSGSHNLIWMTVYKDKLRRCPECGSVYKLKFMGDP
COX5_DICDI/17-113 MEFFHKPASNSLLDASELNFVRRNIKRED-FGHEVLTGAF-GTLKSPVIVESIFHSRIVACEGGDGEEHDILFHTVAEKKPTICLDCGQVFKLKHISSE