EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01206 alignment
(7 sequences with 75 aa)


YRKI_BACSU/3-74 SD--KVLDAKGLACPMPIVRTKKAMNELESGQILEVHATDKGAKNDLTAWSKSGGHDLLEQTDEGDI-LKFWIQK
YRKF_BACSU/4-75 AT--IVLDAKGLACPMPIVKTKKRMKDLKAGEVLEIHATDKGSTADLEAWAKSTGHEYLGTEAEGEI-LRHFLRK
YEDF_ECOLI/6-77 PD--YRLDMVGEPCPYPAVATLEAMPQLKKGEILEVVSDCPQSINNIPLDARNHGYTVLDIQQDGPT-IRYLIQK
Y990_METJA/4-75 AM--KKLDVTGDICPVPVLKTKKALEELNEGEELEVVGDYKPALENIKRFAENNGYTVVLAEETESR-FRIVIKK
SIRA_ECOLI/6-79 SSPDHTLDALGLRCPEPVMMVRKTVRNMQPGETLLIIADDPATTRDIPGFCTFMEHELVAKETDGLP-YRYLIRK
YEED_ECOLI/3-74 IK---KLDVVTQVCPFPLIEAKAALAEMVSGDELVIEFDCTQATEAIPQWAAEEGHAITDYQQIGDAAWSITVQK
Y242_HAEIN/1-72 MK--YQLNLTALRCPIPLLSAKKALKNLDKNDELMLILNLESAVENFSIFAEENSVALVEQYYASEK-EFIVILK