EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01205 alignment
(13 sequences with 115 aa)


Q9ZJD4_HELPJ/14-119 IKASRFLGYLMPFDNFEKT---LLQLKKE--HFKAAHFVTAFRYSLEG..--KITEGFSDDGEPKGSSGMPVLSVLRREDLINIGLVSVRYFGGTLLGVGGLMKAYAKSALLCVE
Q9X238_THEMA/16-122 VKRSEFYATIFPVKDEKDFREKLKEVSKR----DATHNCWAYRIFSP-..-NGILEHSSDDGEPSGTAGRPILGALKKYDLMNTAIVVTRYFGGVKLGVRGLIEAYSSAAEMAVK
YVYE_BACSU/18-125 IEKSRFICHLSRVSTEQEAQEFIQKIKKQ--HWNATHNCSAYVIGE--..-NDHIQKANDDGEPSGTAGVPMLEVLKKRRLKDTCAVVTRYFGGIKLGAGGLIRAYGKSVSEGLN
Q9ZNK1_CLOHI/16-123 EKKSIFIGHVKRVNSEEEAKQFIEEIKEK--YKDARHNVYAYIIGE--..-NMGIQRYSDDGEPKGTGGIPILEVIKKNNITDTVVVVTRYFGGILLGASGLTRAYSKAAVNAIK
Y722_HAEIN/17-126 IKKSRFITYLQHTEGLEDARAFWAKIKQE--HPNARHHCWAAVAGKPT..-DSLQLGFSDDGEPAGTAGKPMLSALQGSQLGEISAVVVRYYGGILLGTGGLVRAYGNGVQQALK
Q9SZK9_ARATH/21-124 IKKSKFIAIAGPISSEQSAQMFLSQVRD----PRASHNCWAYKIGD--..---HHHRCSDDGEPSGTAGKPIQSAILSSGLDRVMVVVIRYFGGIKLGTGGLVRAYGGVTSDCLK
Q9RSC2_DEIRA/21-125 IDHSEFLAFAERADSPEEALAHLAALRTR--YPDATHHCWAYRIG---..---AAYRFGDDGEPGGTAGAPILRAIEGQGVDHVMVVVVRYYGGVKLGTGGLVRAYGGVAAECLR
O51391_BORBU/15-122 IKKSIFVSYIFNIEKKDDINKTIKKYKIK--FKNATHVVYGFRIGNK-..-NSFLNGMSDDREPNLTAGKPTLDAIIHNNLTDTLIITLRYFGGTLLGRGGLIKAYYKSAKEVI-
Q9XWF4_CAEEL/137-249 DRKSAFQAHLAEVRSKEDVDRVMRILKSNTKICRATHNITAYRYMTEIngKPIHHHDCVDDGEFG--ASSKMLELMDRMKADNVMVVVSRWYGGIHLGPDRFRHINNLTRQILSD
Q9W625_XENLA/178-288 DRRSTFQAHLAPVVSPYQVKLILNKLYENKKIATATHNIYAYRIYIKE..RNSFIQDCEDDGETA--AGKRMLHLMQILDARDVMVVVSRWYGGILLGPDRFKHINNCARNVLME
O55091_MOUSE/180-290 DRRSTFQAHVAPVVCPEQVKLVLAKLYENKKIASATHNIYAYRIFCED..KQTFLQDCEDDGETA--AGGRLLHLMEILNVKNVMVVVSRWYGGILLGPDRFKHINNCARNILVE
O13997_SCHPO/152-259 DRKSTFMAHATRVYSTEEVREALEDLYMDKKVAKANHNMVAYRIISP-..NGNVIQDNDDDGESA--AGSRMSHLLTMMSAENVFVCVSRWFGGVHIGPDRFKHINSSAREAV--
YCU9_YEAST/143-253 DRGSTFMAFAAHVTSEEQAFAMLDLLKTDSKMRKANHVMSAWRIKQDG..SAATYQDSDDDGETA--AGSRMLHLITIMDVWNVIVVVARWFGGAHIGPDRFKHINSTAREAVVR