EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01188 alignment
(7 sequences with 275 aa)


YIN2_STRAM/114-383 SRDGV-LVYSHASGTDVPSLLDDVERHLELGYKAVRAQAAVPGVGGTYGVRKGR--VYEPAAS.ELPDEQPWDTEAYLDFAPRYLEAVRERFGFGFHLLHDVHHRLTPNEAARFGKSVEASRLFWMEDPTPAENQESFRLIRQHTTTPIAVGEVMNSIWDVQHLITEQLIDYVRTTVVHAGGITHLRRIFDLAALHQVRTGSHGATDLSPVSMAAAVHLDIAVPNFG-IQEYMGHADETAEVFRTGVTFADGMLHPSDEPGLGVEYDEKAAERFP
RSPA_ECOLI/113-385 SREGV-MVYCHTTGHSIDEALDDYARHQELGFKAIRVQCGIPGMKTTYGMSKGKGLAYEPATKgQWPEEQLWSTEKYLDFMPKLFDAVRNKFGFNEHLLHDMHHRLTPIEAARFGKSIEDYRMFWMEDPTPAENQECFRLIRQHTVTPIAVGEVFNSIWDCKQLIEEQLIDYIRTTLTHAGGITGMRRIADFASLYQVRTGSHGPSDLSPVCMAAALHFDLWVPNFG-VQEYMGYSEQMLEVFPHNWTFDNGYMHPGDKPGLGIEFDEKLAAKYP
TFDD1_ALCEU/128-367 LRSAIPIAWTLASG--------DTKRDLDSAVEMIERRRHN-RFKVKLGFRSPQ---------.-------------DDLIH--MEALSNSLGSKAYLRVDVNQAWDEQVASVYIPELEALGVELIEQPVGRENTQALRRLSDNNRVAIMADESLSTLASAFDLARDRSVDVFSLKLCNMGGVSATQKIAAVAEASGIASYG-GTMLDSTIGTSVALQLYSTVPSLPFGCELIGPFVLADTLSHEPLEIRDYELQVPTGVGHGMTLDEDKVRQYA
TCBD_PSESQ/128-367 MRTSIPIAWTLASG--------DTARDIDSALEMIETRRHN-RFKVKLGARTPA---------.-------------QDLEH--IRSIVKAVGDRASVRVDVNQGWDEQTASIWIPRLEEAGVELVEQPVPRANFGALRRLTEQNGVAILADESLSSLSSAFELARDHAVDAFSLKLCNMGGIANTLKVAAVAEAAGISSYG-GTMLDSTVGTAAALHVYATLPSLPYGCELIGPWVLGDRLTQQDLEIKDFEVHLPLGSGLGVDLDHDKVRHYT
CLCB_PSEPU/128-367 IQQGIPIAWTLASG--------DTQRDIAIAEEMIERRRHN-RFKIKLGVRSPA---------.-------------DDLRH--IEKIIERVGDRAAVRVDINQAWDENTASVWIPRLEAAGVELVEQPVARSNFDALRRLSADNGVAILADESLSSLASAFELARHHCVDAFSLKLCNMGGVANTLKVAAIAEASGIASYG-GTMLDSSIGTAAALHVYATLPTMPFECELLGPWVLADTLTQTQLEIKDFEIRLPSGPGLGVDIDPDKLRHFT
CATB_PSEPU/133-372 VRDSLEVAWTLASG--------DTARDIAEAQHMLEIRRHR-VFKLKIGANPLA---------.-------------QDLKH--VVAIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRSGQVRLNQRSPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIALYG-GTMLEGSIGTLASAHAFLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEQRLARFA
MANR_PSEPU/131-358 ARPVQAYDSHSLDG---------VKLATERAVTAAELGFRA--VKTKIGYPALD---------.-------------QDLAV--VRSIRQAVGDDFGIMVDYNQSLDVPAAIKRSQALQQEGVTWIEEPTLQHDYEGHQRIQSKLNVPVQMGENWLGPEEMFKALSIGACRLAMPDAMKIGGVTGWIRASALAQQFGIPMSS---HLF----QEISAHLLAATPTAH----WLERLDLAGSVIEPTLTFEGGNAVIPDLPGVGIIWREKEIGKYL