EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01182 alignment
(4 sequences with 238 aa)


GNPI_HUMAN/15-250 WAAKYIRNRIIQFNPGPEKYFTLGLPTGSTPLGCYKKLIEYYKNGDLSFKYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENTHILDGNAVDLQAECDAFEEKIKAAGGIELFVGGIGPDGHIAFNEPGSSLVSRTRVKTLAMDTILANARFFDGELTKVPTMALTVGVGTVMD-AREVMILITGAHKAFALYKAIEEGVN-HMWTVSAFQQHPRTVFVCDEDATLELKVK
NAGB_HAEIN/15-250 WAAQHIINRINDFKPTAERPFVLGLPTGGTPLKTYQELIRLYQAGKVSFKHVVTFNMDEYVALPEEHPESYHSFMYNNFFNHIDILPENINILNGNTDDHNAECRRYEEKIKSYGKIHLFMGGVGVDGHIAFNEPASSLSSRTRIKTLTQDTLIANSRFFNNDVTQVPKYALTIGVGTLLD-AEEVMILATGHQKALAVQAAVEGSIN-HLWTVSALQMHRHFLLVCDEAAQQELKVK
NAGB_ECOLI/15-250 WAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTRVANSRFFDNDVNQVPKYALTVGVGTLLD-AEEVMILVLGSQKALALQAAVEGCVN-HMWTISCLQLHPKAIMVCDEPSTMELKVK
NAG1_CANAL/15-247 YLANYIIAKINST-P---RTFVLGLPTGSSPEGIYAKLIEANKQGRVSFKNVVTFNMDEYLGFAPSDLQSYHYFMYDKFFNHIDIPRENIHILNGLAANIDEECANYEKKIKQYGRIDLFLGGLGPEGHLAFNEAGSSRNSKTRKVELVESTIKANCRFFGNDESKVPKYALSVGISTILDNSDEIAIIVLGKSKQFALDKTVNGKPNDPKYPSSYLQDHANVLIVCDN-AAAGLKSK