EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01176 alignment
(4 sequences with 102 aa)


IF1A_YEAST/13-113 RRGKNDSDGPKRELIYKEEGQEYAQITKMLGNGRVEASCFDGNKRMAHIRGKLRKKVWMGQGDIILVSLRDFQ-DDQCDVVHKYNLDEARTLKNQGELPENA
IF1AX_HUMAN/12-112 RRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQ-DNKADVILKYNADEARSLKAYGELPEHA
IF1A_METJA/1-102 MAEQQQEQQIRVRIPRKEENEILGIIEQMLGASRVRVRCLDGKTRLGRIPGRLKNRIWVREGDVVIVKPWEVQGDQKCDIIWRYTKTQVEWLKRKGYLDELL
IF1A_THEAC/15-115 SGEENEESIGRVILPNKKKGEMFGIVEKMEGASRLSVMCEDGYTRNARIPGRMRKRMWIREKDLVIVKPWEFQ-PEKADVVYRYTKTQASYLSRNHMLPEVI