EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01174 alignment
(5 sequences with 211 aa)


YMY5_YEAST/18-223 VLALQGAFLEHTNHLKRCLAEN-D.YGIKIEIKTVKTPEDLAQCDALIIPGGESTSMSLIAQRTGLYPCLYEFVHNPEKVVWGTCAGLIFLSAQLENESALVKTLGVLKVDVRRNAFGRQAQSFTQKCDFSNFIPGCDNFPATFIRAPVIERILDPIAVKSLYELP--VNG-KDVVVAATQNHNILVTSFHPELADSDTRFHDWFIRQFVS
YFG0_YEAST/7-217 VLALQGAFIEHVRHVEKCIVENRDfYEKKLSVMTVKDKNQLAQCDALIIPGGESTAMSLIAERTGFYDDLYAFVHNPSKVTWGTCAGLIYISQQLSNEAKLVKTLNLLKVKVKRNAFGRQAQSSTRICDFSNFIPHCNDFPATFIRAPVIEEVLDPEHVQVLYKLDGKDNGGQELIVAAKQKNNILATSFHPELAENDIRFHDWFIREFVL
Y1661_METJA/5-185 VLAIQGDVEEHEEAIKKAGYEA--.-------KKVKRVEDLEGIDALIIPGGESTAIGKLMKKYG----LLEKIKNSNLPILGTCAGMVLLSKGTGIN--QIL-LELMDITVKRNAYGRQVDSFEKEIEFKDLG----KVYGVFIRAPVVDKILSDDVEVIARDGD-------KIVGVK-QG-KYMALSFHPELSEDGYKVYKYFVENCVK
YAAE_BACSU/6-189 VLGLQGAVREHIHAIEACGAAG--.-------LVVKRPEQLNEVDGLILPGGESTTMRRLIDTYQFMEPLREFAAQG-KPMFGTCAGLIILAKEIAGS--DNPHLGLLNVVVERNSFGRQVDSFEADLTIKGLD---EPFTGVFIRAPHILEAG--ENVEVLSEHN----G--RIVAAK-QG-QFLGCSFHPELTED-HRVTQLFVEMVEE
Y1648_HAEIN/1-174 MLEKLG-----IESVELRNLKN--.-----------FQQHYSDLSGLILPGGESTAIGKLLRELYMLEPIKQAISSG-FPVFGTCAGLILLAKEITSQ--KESHFGTMDIVVERNAYGRQLGSFYTEADCKGVG----KIPMTFIRGPIISSVG--KKVNILATVN------NKIVAAQ-EK-NMLVTSFHPELTNN-LSLHKYFIDICKV