EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01172 alignment
(3 sequences with 248 aa)


YL22_YEAST/4-245 NQPSGQIKLTNVSLVRLKKARKRFEVACYQNKVQDYRKGIEKDLDEVLQIHQVFMNVSKGLVANKEDLQKCFGTTNVDDVIEEIMHKGEIQLSEKERQLMLNKVNNEMLTIVSAKCINPVSKKRYPPTMIHKALQELKFSPVINKPAKLQALEAIKLLVSKQIIPIVRAKMKVKVAISEPSRQPELIEKISK-LIASSPGESTKPELDPWTCTGLIDPVNYRDLMTLC--DKKGT--VQVLDMA-VID
YOM4_CAEEL/6-247 KTPTNQKVLTNVAVVRMKKTGKRFEIACYKNKVVNWRNKSEKDIDEVLQTHTVFSNVSKGQLSKKEELIAAFGIEDQLEICKIILDKGDLQVSEKERQAASDQSLKEVSQLIASMVVNPETKRPVPPSVIDKALQEMHFSLKPNRSSKQQALDAIPKL--RETLKIERAKMKIRVAI--PTKEAKSVHTKLKTLFSDV-EVDDWQ-DGSLEMVGLIEPGSFRALDDLVRNETKGHGRLEILSLKDVVE
Y592_METJA/1-240 MGRDIMVSLEEAVIARYTSHGEKFEILVDPYLAAKLKEGQNVDFDELLAIEVVFRDASKGEKAPEELLSKIFGTTDVKEIAKKIILKGQVQLTAKQREEIREQKKRQIITIISRNTINPQTDTPHPPHRIEKAMEELRINIDIYKSAEEQVPEIVKKL--KKVLPIRFEKRDIAVKI--PAEFASKAYNALY-QFGAV-KQEEWQPDGSLIVLIEIPSGIEAEFYAHLNKITKGN--VQTKVVKKYSE