EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01166 alignment
(4 sequences with 60 aa)


YAE7_CAEEL/43-102 MDLVKTHLTFAVREEVETLRTTITDLEARLNALREENRLLRENVSPEVLAFITANKQLCE
TS22_CHICK/59-118 MDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENTLLKTLASPEQLAQFQAQLQTGS
GILZ_HUMAN/58-117 MDLVKNHLMYAVREEVEILKEQIRELVEKNSQLERENTLLKTLASPEQLEKFQSCLSPEE
BUN1_DROME/64-123 MDLVKSHLMIAVREEVEVLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAA