EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01132 alignment
(10 sequences with 192 aa)


EFP_SYNY3/1-185 MISSNDFRTGTSIVMDGA-VWKVVEFLHVKP-GKGSA-FVRTKLKSVQTGNVVEKTFRAGETVPQANIEKSVMQHTYKDGDQYVFMDMETFEEVSIAPDTLGDKAKFIKEE--MEVSVV.-TWDGTILDVELPTSVVLEIVETDPGVKGDTATGGTKPAILETGAQVMVPLFIAQGERIKVDTRDGSYLGRD
EFP_ANASP/1-185 MISSNDFRPGVSIVLDGS-VWRVIDFLHVKP-GKGSA-FVRTTLKNVQSGKVLEKTFRAGETVPQATLEKITMQHTYKEGDEFVFMDMESYEEGRLSAAQIGDRVKYLKEG--MEVNVI.-RWGEQVLEVELANSVVLEVIQTDPGVKGDTATGGTKPAIVETGATVMVPLFISQGERIKIDTRDDKYLGRE
EFP_BACSU/1-185 MISVNDFRTGLTIDVDGG-IWRVVDFQHVKP-GKGAA-FVRSKLRNLRTGAIQEKTFRAGEKVAKAQIETKTMQYLYANGDQHVFMDTSSYEQLELSATQIEEELKYLLEN--MSVHIM.-MYQDETLGIELPNTVELKVVETEPGIKGDTASGGTKPAKTETGLVVNVPFFVNEGDTLVVNTSDGSYVSRA
EFP_MYCTU/1-185 MATTADFKNGLVLVIDGQ-LWTITEFQHVKP-GKGPA-FVRTKLKNVLSGKVVDKTFNAGVKVDTATVDRRDTTYLYRDGSDFVFMDSQDYEQHPLPEALVGDAARFLLEG--MPVQVA.-FHNGVPLYIELPVTVELEVTHTEPGLQGDRSSAGTKPATLQTGAQINVPLFINTGDKLKVDSRDGSYLGRV
EFP_CORGL/1-185 MATTADFKNGLVLKNEGK-LQQIIEFQHVKP-GKGPA-FVRTKLKDVVTGKTIDKTWNAGVKVETATVDRRDVTYLYNDGTSFIVMDDKTFEQYELSPDAFGDAGRFLLEN--MRVQVS.-FHEGEALFGELPVSVDLRVEHTDPGLQGDRSTGGTKPATLETGAEIQVPLFIETGNVLKVDTRDGSYLSRV
EFP_BACFR/1-186 MINAQDIKNGTCIRMDGK-LYFCIEFLHVKP-GKGNT-FMRTKLKDVVSGYVLERRFNIGEKLEDVRVERRPYQYLYKEGEDYIFMNQETFDQHPIAHDLI-NGVDFLLEG--AVVEVVsDASTETVLYADMPIKVQMKVTYTEPGLKGDTATNTLKPATVESGATVRVPLFISEGETIEIDTRDGSYVGRV
EFP_HELPY/2-186 AIGMSELKKGLKIELGGV-PYRIVEYQHVKP-GKGAA-FVRAKIKSFLDGKVIEKTFHAGDKCEEPNLVEKTMQYLYHDGDTYQFMDIESYEQIALNDSQVGEASKWMLDG--MQVQVL.-LHNDKAISVDVPQVVALKIVETAPNFKGDTSSASKKPATLETGAVVQVPFHVLEGEIIKVNTETEEYLEKV
EFP_HAEIN/2-186 TYTTSDFKPGLKFMQDGE-PCVIVENEFVKP-GKGQA-FTRTRIRKLISGKVLDVNFKSGTSVEAADVMDLNLTYSYKDDAFWYFMHPETFEQYSADAKAVGDAEKWLLDQ--ADCIVT.-LWNGAPITVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIRVDTRSGEYVSRV
EFP_ECOLI/2-186 TYYSNDFRAGLKIMLDGE-PYAVEASEFVKP-GKGQA-FARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQ--AECIVT.-LWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRV
EFP_MYCGE/4-188 MIEAKNLRNGQTIFGPNKEILLVLENTFNKT-AMRQG-IVKTKVKNLRTGAIVWLEFT-GDKLEQVIIDKKKMNFLYKDGNNFVFMDQKDYSQIEINEKKLEWEKNFITEE--IEVTVI.-TYQDEILGVNLPDLVPIEVEFAEDAIQGNTANMARKKARLVTGYELDVPQFINTGDKIVIATVDGNYRERF