EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01099 alignment
(6 sequences with 94 aa)


UTER_LEPCA/1-90 MKLTITLALVTLALLCSPASAG-ICPGFAHVIENLLLG--TPSSYETSLKEFQPDDAMKDAGMQMKKVLDT-LPQTTRENIIKLTEKIVKSPLC
UTER_HUMAN/1-90 MKLAVTLTLVTLALCCSSASAE-ICPSFQRVIETLLMD--TPSSYEAAMELFSPDQDMREAGAQLKKLVDT-LPQKPRESIIKLMEKIAQSSLC
UTER_MOUSE/1-90 MKIAITITVVMLSICCSSASSD-ICPGFLQVLEALLME--SESGYVASLKPFNPGSDLQNAGTQLKRLVDT-LPQETRINIMKLTEKILTSPLC
FELA_FELCA/1-92 MKGACVLVLLWAALLLISGGNCEICPAVKRDVDLFLTG--TPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENALSVLDKIYTSPLC
PSC3_RAT/1-91 MKLVFLFLLVTIPICCYASGSG--CSILDEVIRGTINSTVTLHDYMKLVKPYVQDHFTEKAVKQFKQCFLD-QTDKTLENVGVMMEAIFNSESC
MGBA_HUMAN/1-90 MKLLMVLMLAALSQHCYAGSG---CPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLN-QTDETLSNVEVFMQLIYDSSLC