EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01096 alignment
(6 sequences with 39 aa)


Q98202_MCV1/155-193 APCPVCRGLNTTPMILQTRASDEEPTVRYVCKDCNKHFS
RPO5_VARV/157-195 TPCPNCKSRNTTPMMIQTRAADEPPLVRHACRDCKQHFK
TFS2_ASFB7/204-242 YKCPNCKQRMCTYREVQTRALDEPSTIFCTCKKCGHEFI
Q84444_CHVP1/141-179 LQCGKCKSRKTSYYEMQTRSADEPMTVFAKCHSCGSRWK
TFS2_YEAST/269-307 FTCGKCKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK
TCEA1_HUMAN/261-299 FTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWK