EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01087 alignment
(10 sequences with 222 aa)


GAL7_YEAST/3-191 EEFDFSSHSHRRYNPLTDSWILVSPHRAKRP--------------WLGQQEAAYKPTAPLYDPKCY---LCPGNKRATGNLNPRYESTYI------FPNDYAAVRLDQPILPQNDSNEDNLKNRLLKVQSVRG--NCFVICFS-PNHNLTIPQMKQSDLVHIVNSWQALTDDLSREARENHKPFKYVQIFE-NKGTAMGCSNLHP------HGQAWCLESIP
GAL7_KLULA/1-189 MSFDLTDHSHARYNPLTDSWILVSPHRAKRP--------------WLGQQEKPGRNDAPDHDDKCY---LCPGTTRATGEQNPDYESTYV------FTNGYPAVKLEQPDPELTVSNCDALKERLFKLKGVKG--NCYVICFS-PKHNLSFPQMAQSEIMNVVKTWTNLFQTLEKEALEENKPYKYLQIFE-NKGTAMGCSNLHP------HGQAWCLDSIP
GAL7_HAEIN/3-177 ALFEPTEHPHRRYNPLIDQWVLVSPHRAKRP--------------WQGQQEKVNEEQKPSYDPTCY---LCPSNKRITGELNPDYRKPYV------FKNDFSALLEDTPAPEKS-------SDPLFQSSQARG--ESRVICFS-PDHSKTLPLLTALEIEEVIKVWQEQLRELG-------AKYQWVQIFE-NKGAAMGCSNPHP------HGQIWANSFLP
GAL7_ECOLI/2-176 TQFNPVDHPHRRYNPLTGQWILVSPHRAKRP--------------WQGAQETPAKQVLPAHDPDCF---LCAGNVRVTGDKNPDYTGTYV------FTNDFAALMSDTPDAPES-------HDPLMRCQSARG--TSRVICFS-PDHSKTLPELSVAALTEIVKTWQEQTAELG-------KTYPWVQVFE-NKGAAMGCSNPHP------HGQIWANSFLP
GAL7_HUMAN/22-196 ATFRANDHQHIRYNPLQDEWVLVSAHRMKRP--------------WQGQVEPQLLKTVPRHDPLNP---LCPGAIRANGEVNPQYDSTFL------FDNDFPALQPDAPSPGPS-------DHPLFQAKSARG--VCKVMCFH-PWSDVTLPLMSVPEIRAVVDAWASVTEELG-------AQYPWVQIFE-NKGAMMGCSNPHP------HCQVWASSFLP
GAL7_CRYNE/15-198 TPVSINDHVHRRFNPLLGKHVLVSPHRSLRP--------------WNGQKETPAIPVETPHDSKCY---LCPGNKRTTGQHNPDYKGIYV------FENDFPALLPDPLAVGTN----KISDDPLFQSEPVRG--RCKVICFH-PRHDLTMAAMRISEINHVLDGWKDVYAEEGK-IMQEESSDGCVQIFE-NRGAMMGCSAPHP------HGQVWTTSFVP
GAL7_STRLI/2-177 KKTSTRLADGRELVYYDLRDDTVRDAVDRRP--------------LERTVTTSEVRRDPLLGDSAP----SRLAPQGRTYHPPADQCPLC-------PSGRGTAERDPAYDVVV------FENRFPSLAGDSG--RCEVVCFT-SDHDASFADLSEEQARLVVDAWTDRTSELS-----HLPSVEQVFCFE-NRGAEIGVTLGHP------HGQIYAYPFTT
GALT_LACHE/15-221 GAYEPLDRVYVINKIRALVGDHDEEEENDQP---------AAKQLVDLAVKNEKIP-DDITSREVLNDQLYDLATPTPSKTNSIFWQKMQ-KSSEENTDWFYKLCEDNNYVKKE----AIAKNVVFSGTSSKGHSLEITINLSKPEKDPKAIAAAAHATGKKYPQCALCLENEGYLGGYGKNARSNLRIIRMNIAGRPWGFQYSPYAYFNEHCIFLDQKHIP
GALT_STRMU/16-225 SDYAELDATYLSNRILALVGEDNAQQDTNQS-----NLIALKDELVDLAVVNGKVG-DLAEEKDCLGAELMNFITPIPSQVNKAFWDTNA-KSPQKAIKDFYELSKRNNYIKVT----AIAKNIAFTTSSVYG-DIDITINLSKPEKDPKAIAAAKLAKTSNYPKCQLCMENEGYQGRINYPARANHRIIRMNLGDEKWGFQYSPYAYFNEHCIFLNTEHVP
GALT_BACSU/18-234 KLISIWDREYTRNRLYEALGITHPEPNSSTSIKQSQSLPDLLAPIYKWAAETGRMEADTDTYRDLLSAKLMGCFVPAPSEVIRKFEETKALYGPKQATKEFYQYSEDVYYIRTD----RIAKNVHWTVPTEYG-ELEMTINLSKPEKDPKAIAAAKEQEQTNYPMCLLCKENVGFEGSVNHPARQNHRIIPVILEDEQWFLQFSPYVYYPEHCIVLKGEHEP