EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01085 alignment
(3 sequences with 163 aa)


IHH_BRARE/24-184 CGPGR..GYGKRRTPRKLTPLAYKQFSPNVAEKTLGASGRYEGKVTPSSERFKELTPNYNPDIIFKDEENTGADRMMTQRCKDKLNSLAISVMNLWPGVRLRVTEGWDEDGLHSEESLHYEGRAVDITTSDRDRNKYRMLARLAVEAGFDWVYYESKGHVHCS
DHH1_XENLA/23-184 CGPGRgpVGRRRY-MRKLVPLHYKQFVPNVPEKTLGASGKSEGKIHRGSERFIELVPNYNPDIIFKDEEKTGADRLMTERCKDRVNALAISVMNMWPGVKLRVTEGWDEDGHHAHDSLHYEGRALDITTSDRDRNKYGMLARLAVEAGFDWVYYESKAHIHVS
O17499_BRAFL/28-188 CGPGG..RFGRRRHPRKLTPFVYKQQMPAVSENTFGASGLFNGRITRDSERFHTLKQNFNTDIIFKDEEKTGADRFMTQRCKDKLNALAISVMNQWEGVKLRVTEGWDEDGFHTEESLHYEGRAVDITTSDRDRTKYGMLARLAVEAGFDWVYYESKAHIHCS