EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01024 alignment
(9 sequences with 203 aa)


CEAN_ECOLI/185-382 KEEKEKNEKEALLKASELVSGMGDKLGEYLGVKYKNVAKEVANDIKNFHGRNIRSYNEAMASLNKVLANPKMKVNKSDKDAIVNAWKQVNAKDMANKIGNLGKAFKVADLAIKVEKIREKSIEGYNTGNWGPLLLEVESWIIGGVV----AGVAISLFGAVL-SFLPISGLAVTALGVIGIMTISYLSSFIDANRVSNINNII
CEA_CITFR/389-587 VAEKAKDERELLEKTSELIAGMGDKIGEHLGDKYKAIAKDIADNIKNFQGKTIRSFDDAMASLNKITANPAMKINKADRDALVNAWKHVDAQDMANKLGNLSKAFKVADVVMKVEKVREKSIEGYETGNWGPLMLEVESWVLSGIA----SSVALGIFSATLGAYALSLGVPAIAVGIAGILLAAVVGALIDDKFADALNNEI
O24681_SHIBO/416-614 AEEKANDEKAVLTKASEIIISVGDKAGEYLGDKYKVLSREIADNIKNFQGKTIRSYDEAMASVNKLMANPDLKINAADRDAIVNAWKAFDAEDMGNKFAALGKTFKAADYVMKANNVREKSIEGYQTGNWGPLMLEIESWVLSGIA----SAVALSFFSAIFGTFAMLGVFSTSLAGILAVILAGLVGALIDDNFVDKLNNEI
CEAB_ECOLI/310-508 KKEQENDEKTVLTKTSEVIISVGDKVGEYLGDKYKALSREIAENINNFQGKTIRSYDDAMSSINKLMANPSLKINATDKEAIVNAWKAFNAEDMGNKFAALGKTFKAADYAIKANNIREKSIEGYQTGNWGPLMLEVESWVISGMA----SAVALSLFSLTLGSALIAFGLSATVVGFVGVVIAGAIGAFIDDKFVDELNHKI
Q06308_SERMA/258-446 --EYQNAELKAIKDGVSLAAGINKDIAEKIGAKYAKLAKDLEAGIQ---GKYIRNVQDAEKTYEQLTKGLNKKLKAQDKAAIVAWLKMIDAEQYARNARVLGKVFTGVDWAIKGADLVNAAIEGFSTGNWKAFRNQLEALGLSIGAGYTLSAIAAFFAPTLVSSTVGIFAFAYLFG---------WATSYIDAERAGELEKWV
CEIB_ECOLI/438-624 EEKRKRDEINMVKDAIKLTSDFYRTIYDEFGKQASELAKELASVSQ---GKQIKSVDDALNAFDKFRNNLNKKYNIQDRMAISKALEAINQVHMAENFKLFSKAFGFTGKVIERYDVAVELQKAVKTDNWRPFFVKLESLAAGRAA----SAVTAWAFSVMLGTPVGILGFAIIMA---------AVSALVNDKFIEQVNKLI
CEIA_ECOLI/438-624 EEKRKQDELKATKDAINFTTEFLKSVSEKYGAKAEQLAREMAGQAK---GKKIRNVEEALKTYEKYRADINKKINAKDRAAIAAALESVKLSDISSNLNRFSRGLGYAGKFTSLADWITEFGKAVRTENWRPLFVKTETIIAGNAA----TALVALVFSILTGSALGIIGYGLLMA---------VTGALIDESLVEKANKFW
CEAK_ECOLI/360-546 KEAQDALEKSQIKDAVDTMVGFYQYITEQYGEKYAKIAQDLAEKSK---GKKIQGVDEALAAFEKYKNVLDKKFSKVDRDAIFNALESVNYDELSKNLTKISKSLKITSRVSFLYDVGSDFKNAIETGNWRPLFVTLEKSAVDVGV----AKIVALMFSFIVGVPLGFWGIAIVTG---------IVSSYIGDDELSKLNELL
CEA1_ECOLI/334-520 KKAQNNLLNSQIKDAVDATVSFYQTLTEKYGEKYSKMAQELADKSK---GKKIGNVNEALAAFEKYKDVLNKKFSKADRDAIFNALASVKYDDWAKHLDQFAKYLKITGHVSFGYDVVSDILKIKDTGDWKPLFLTLEKKAADAGV----SYVVALLFSLLAGTTLGIWGIAIVTG---------ILCSYIDKNKLNTINEVL