EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01023 alignment
(21 sequences with 44 aa)


TRHY_SHEEP/4-47 LLRSIFNITKIFNQYASHDCDGTTLSKKDLKNLLEREFGEILRK
TRHY_RABIT/4-47 LLKSIIDIIEIFNQYASHDCDGAVLKKKDLKILLDREFGAVLQR
REPT_MOUSE/4-47 LLNSILNVSKVFQDYAEYHGVGASLSKKELKQLLLTEFGDILRR
Q01720_HUMAN/4-47 LLENIFAIINLFKQYSKKDKNTDTLSKKELKELLEKEFRQILKN
S10AC_HUMAN/3-46 LEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKN
S10AC_BOVIN/3-46 LEDHLEGIINIFHQYSVRVGHFDTLNKRELKQLITKELPKTLQN
S10A9_RAT/8-51 LERSISTIINVFHQYSRKYGHPDTLNKAEFKEMVNKDLPNFLKR
S10A9_HUMAN/8-51 LERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKK
S10A9_MOUSE/8-51 MERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKK
S10I_ICTPU/4-47 LQKGMALLISTFHKYSGKEGDKCTLTKGELKDLLTKELGGAFGN
S10A6_CHICK/5-46 LDQAIGLLVATFHKYSGKEGDKNSLSKGELKELIQKELTIGP--
S10A4_BOVIN/4-47 LEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGK
S10A3_HUMAN/5-48 LEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPT
S100P_HUMAN/4-47 LETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQS
S10AD_BOVIN/9-51 LEAAIETVVTTFFTFAGREGRKGSLSVNEFKELVTQQLPHLLK-
S10A7_BOVIN/6-46 LEQAITDLINLFHKYS---GSDDTIEKEDLLRLMKDNFPNFLGA
S10AB_HUMAN/10-53 TERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKN
S10AB_CHICK/9-52 TERCIESLLAVFQRYAGREGDNLKLSKKEFRTFMNTELASFTKN
S10A8_MOUSE/4-47 LEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQN
S10A8_HUMAN/5-48 LEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRK
S10AA_CHICK/1-44 PSQMEHAMETLMFTFHKYAGDKNYLSKEDLRALMEKEFPGFLEN