EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00992 alignment
(19 sequences with 147 aa)


TRT3_CHICK/68-210 KRQNKDLIELQALIDSHFEARRKEEEELVALKER-IEKRRAERAEQQRIRAEKEKERQARLAEEKARREEEDAKRKAEDDLKKKKALSSMGASYSSYLAKADQ-..KRGKKQTARETKKKVLAERRKPLNIDHLNEDKLRDKAKELW
TRT3_MOUSE/75-217 KRQNKDLMELQALIDSHFEARKKEEEELIALKER-IEKRRAERAEQQRIRAEKEREPQNRLAEEKARREEEDAKRRAEDDMKKKKALSSMGANYSSYLAKADQK..-RGKKQTAREMKKKILAERRKPLNIDHLSDDKLRDKAKELW
TRT2_MOUSE/105-249 KRVEKDLNELQTLIEAHFENRKKEEEELISLKDR-IEKRRAERAEQQRIRNEREKERQNRLAEERARREEEENRRKAEDEARKKKALSNM-MHFGGYIQKQAQTerKSGKRQTEREKKKKILAERRKALAIDHLNEDQLREKAKELW
Q98916_CHICK/73-214 KRMEKDLLELQTLIDAHFEQRRREENELVALMER-IERRRAERNEQLRSRTEKERERQARLAEEKLRKEEEEAKKRAEDDAKKKKVLSNM-PHFGGYLAKAEQ-..RRGKRQTGREMKLRILAERKKPLHIEHMREDELRAKAKELH
Q25149_HALRO/34-177 KRMDKVLLELQSLISSHFETRKRAGGEIDQLRIR-IEERKACREEQMRVRQEKEKERMAREREDRKRKEEEEGQKRFEEEAKRKAAIANMSLHYGGYLARPIKI..SPNKRQTDREKKKKILSDRRKPLNVDHLSAEKLQEKASELW
Q25148_HALRO/44-187 KRHQKDLEELQALITAHFEQRKQEEEQLEELRLR-LEKRKEERAERLRIREEKTKERVAREREERKHKEEEDEKKRKEEEEKKKAAIANMSLHYGGYLARAEKN..KPNKRQTEREKKKKLLAERKKNISVDHLSPDKLREKAQELW
TRI_DROME/104-233 KKKLRLLLRKKAAEELKKEQERKAAERRRIIEERCGSPRNLSDASE-GELQEICEEYYERMY--ICEGQKWDLEYEVRKKDWEINDLNAQVNDLRGKFVKPALK..--KVSKYENKFAKLQKKA---------AEFN-FRNQLKVVK
Q20334_CAEEL/58-191 KKKLRKLLMNKAAEDLKTQQLRKEQERVKVLAERTVALPNVDSIDDHAKLEAIYNDLFSRLC--NLEEEKYDINHITTETETTINQLNIEVNDLRGKFVKPSLK..--KVSKYDNKFKKMAEAKKED------GSKN-LRNNLKTVK
TNNI2_HUMAN/14-144 RQHLKSVMLQIAATELEKEESRREAEKQNYLAEH-CPPLHIPGS--MSEVQELCKQLHAKID--AAEEEKYDMEVRVQKTSKELEDMNQKLFDLRGKFKRPPLR..--RVRMSADAMLKALLGSKHK------VCMD-LRANLKQVK
TNNI2_COTJA/14-144 RQHLKSAMLQLAVTEIEKEAAAKEVEKQNYLAEH-CPPLSLPGS--MQELQELCKKLHAKID--SVDEERYDTEVKLQKTNKELEDLSQKLFDLRGKFKRPPLR..--RVRMSADAMLRALLGSKHK------VNMD-LRANLKQVK
TNNI3_XENLA/70-201 KLQLNTMMLQIAKAEMEREEEERAREKERYLAEH-CQPLQLSGLS-RSELQDLCQELHARID--VVDEERYDMEAKVNKNITELEDLNQKIFDLRGKFKKPNLR..--RVRLSADAMMMALLGTKHK------VSMD-LRANLKQVK
Q90350_COTCO/16-147 KLLLKSLMLAKAKEEWDQEIVDKQSEKERYLSER-ITPLHTSGLS-LSQLQDLCRELHEKVE--IVDEERYDIEAKCNHNTREIKDLKLKVLDLRGKFKRPPLR..--RVRVSADAMLRALLGSKHK------VSMD-LRANLKSVK
O01355_HALRO/13-145 KLQLKSLLLNRAREDLKREAEQKAEEKKKILNNR-IESLGDLSSMSQQELMELCRELHAKTD--KVDDERFDIELKVKKNDQEIEELNQKIFELRGKFKRPPLR..--RVRMSADQMLRALLGSKHK------VTMD-LRSNLKTVK
O01354_HALRO/15-147 KQNLKSLMLNKAREDLKREAEVKAEEKKKILNSR-IEPLSNLGGMSEQDLKDLCRELHAKIE--KVDEQRYDIEVKVNKNDQEIEDLNQRIFDLRGKFKRPPLR..--RVRMSADQMLRALLGSKHK------VSMD-LRSSLKSVK
TNNI3_CHICK/1-129 KLQLKTLLLQRAKRELEREEQERAGEKQRHLGGL-CPPPELEGLG-VAQLQELCRELHARI---AVDEERYDMGTRVSKNMAEMEELRRRVAGGR--FVRPALR..--RVRLSADAMMAALLGSKHR------VGTD-LRAGLRQVR
Q90365_CLUHA/11-140 KHHLKSVMLAIAATRLEQEAADAIAAKETYLSDN-CPSLDYPSS--IEDLQKLCKELHSKID--IVDEDRYDAESKVTKGAKEVEDLLFKVTELKG-MKKPALK..--KVRLSADQMLQALLGSKHK------VSMD-LRSNLKQVK
O13094_SALSA/13-143 KHTLKSCMLALAKDWLEAEALEKVKERERYMAEN-CPPLEMSHS--KEDLMELCKKMYDKIN--VIDEERYNLEYKVIMVCNEVLDLNIKIVDLRGKFKKPALK..--KVRMSADAMLQALLGSKHK------VTMD-LRSNLKQVK
O13093_SALSA/11-139 KHHLKSLMLQIAANLIEEEKKEMKQEKVNFMAN--IPALDLSGD--QAMLMEMLKKLSQTID--KVDEERYDAEAKVKKTEKEIEDLKMKVIEVQG-IKKPALK..--KVRMSADAMLAALLGTKHK------ASMD-FRANLKEVK
O15987_PATYE/99-241 NRQQEELRRQRQEEERQRREEEQRRQQEEEERLRLEREEQEREEEARRMAEEQKKKKKKGLGGLSPEKKKMLKKLIMQKAAEDLKNEAKAKAEAKEKYINDLVP..KFSTDGKDVAALQALCKDFHKKLAS--LEEDVYDWEAKIRK