EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00984 alignment
(27 sequences with 100 aa)


Y428_METJA/202-293 AKTAEMVKLMENTYRDVNIALANEFAKIAEEIGINVWEAIELANKHPRVN-.--ILKPGPGVGGHCISIDPWFIVEKS----KNAKLIRTARELNDSMPL
O26924_METTH/203-298 LMTAEMVKLMENTYRDTNIALANELAVICEALGIDAINAIEAANHHPRVN-.--IHTPGPGVGGHCLSIDPYFIVEMAERKGVPARLIRTAREVNESMPL
P72381_STAAU/197-289 ARTAEMSKLMENTYRDVNIALANELTKICNNLNINVLVVIEMANKHPRVN-.--IHQPGPGVGGHCLAVDPYFIIAKDP---ENAKLIQTGREINNSMPA
EPSD2_RALSO/211-303 ARTAEMCKLTENAFRDVNIAFANELSMICDEIGVNVWELISVANRHPRVN-.--ILQPGPGVGGHCIAVDPWFIVDAAP---ESARLIRTAREVNDAKPH
WECC_ECOLI/205-297 SRTAEMCKLTENSFRDVNIAFANELSLICADQGINVWELIRLANRHPRVN-.--ILQPGPGVGGHCIAVDPWFIVAQNP---QQARLIRTAREVNDHKPF
VIPA_SALTI/201-295 IKVAEAAKVIENTQRDLNIALVNELAIIFNRLNIDTEAVLRAAGSKWNFL-.--PFRPG-LVGGHCIGVDPYYLTHKSQGIGYYPEIILAGRRLNDNMGN
CAPL_STAAU/196-290 IKVAEAAKVIENTQRDVNIALMNELAIIFDKLDIDTNEVLKASGTKWNFL-.--NFKPG-LVGGHCIGVDPYYLTHKAQEVGHHPEVILAGRRINDNMAK
Q55042_SHISO/202-295 IKVERLQSNVN-TQRDVNIALINELSIIFNKLGIDTLEVLEAAGTKWNLL-.--PFRPG-LVGGHCIGVDPYYLTHKAQSVGYHPEMILAGRRLNDSMGQ
P72132_PSEAE/211-307 TKAAEMTKLLENIHRAVNIGLVNEMKIVADRMGIDIFEVVDAAATKPFGF-.-TPYYPGPGLGGHCIPIDPFYLTWKAREYGLHTRFIELSGEVNQAMPE
UGDH_SOYBN/209-306 LWSAELSKLAANAFLAQRISSVNAMSALCEATGANVQQVSYSVGTDSRIG-.PKFLNASVGFGGSCFQKDILNLVYICECNGLPEVAEYWKQVIKINDYQ
UGDH_CAEEL/220-317 TWSSELSKLVANAFLAQRISSINSISAVCEATGAEISEVAHAVGYDTRIG-.SKFLQASVGFGGSCFQKDVLSLVYLCESLNLPQVADYWQGVININNWQ
UGDH_DROME/209-306 TWSSELSKLAANAFLAQRISSINSLSAVCEATGADVSEVARAVGLDSRIG-.SKFLQASVGFGGSCFQKDILNLIYICENLNLPEVAAYWQQVIDMNEYQ
Y1054_METJA/198-295 WETAELIKYASNAFLATKISFINELAKLSDKVKADIKTISYAMGLDPRIG-.NKFLNAGIGYGGSCFHPDEVLFIDRGRGLECITFKELFELEDKDNVKI
P96718_BACSU/197-292 IRSAEMIKYASNAFLATKISFINEISNICEKVGADIEAVAYGMGQDKRIG-.SQFLKAGIGYGGSCFPKDTNALVQIAGNVEHDFE--LLKSVIKVNNNQ
P72834_SYNY3/219-314 LSSAEMIKYAANAFLATKISFINEVANICDRVGADVTQVAQGIGLDSRIG-.SKFLNAGIGWGGSCFPKDVSALIHTAKDYGYTTS--ILNAVVEVNQVQ
TUAD_BACSU/198-293 LESAEMIKYAANAFLATKISFINDIANICERVGADVSKVADGVGLDSRIG-.RKFLKAGIGFGGSCFPKDTTALLQIAKSAGYPFK--LIEAVIETNEKQ
O29659_ARCFU/243-338 IKTAEMIKYASNAFLATKISFANEIGNICKKLRIDVYKVFEGVGLDHRIN-.PSFFRAGIGFGGSCFPKDVRALIRKSEELGENPK--ILKAVMEVNERQ
O34862_BACSU/196-291 LAGAELIKYANNFFLAAKISFINEMARICEAYQSDISDISRAIGLDPRIG-.KHFLQAGIGYGGSCFPKDLQALQFAAQEKNTETF--LLRAVQHINDTQ
O31279_ACEXY/206-301 LETAELIKYSANSFLAMKITFINEISDLCEKVGANVNDVARSIGLDGRIG-.KKFLHPSPGFGGSCFPKDTRALTAIGRNAGSPVR--LIETTVAVNEQR
UDG_RICPR/197-292 LVTSELIKYVSNSFLATKIAFINEMADLCEKIGANIKDLSQGVGLDQRIG-.RNFLNAGPGFGGSCFPKDILALNNLVENHKIDCK--ILKSVIKSNKLR
O07248_MYCTU/203-300 LQTAELVKVSANAFLATKISFINAISEVCEAAGADVSQLADALGYDPRIG-.RQCLNAGLGFGGGCLPKDIRAFMARAGELGADQALTFLREVDSINMRR
Q56812_XANCA/203-296 VRSAELTKYAANAMLATKISFMNEIANIAERVGADVEHVRNGIGSDPRIG-.--WHFIYPVPATARASRRCAGARKTAHEYGMQPT--LLNAVESVNNAQ
ALGD_PSESH/203-300 IAVAEMIKYTCNVWHATKVTFANEIGNIAKAVGVDGREVMDVVCQDKALNLsQYYMRPGFAFGGSCLPKDVRALTYRASSLDVEAP--LLNSLMRSNTSQ
ALGD_PSEAE/203-300 VEVAEMIKYTCNVWHAAKVTFANEIGNIAKAVGVDGREVMDVICQDHKLNLsRYYMRPGFAFGGSCLPKDVRALTYRASQLDVEHP--MLGSLMRSNSNQ
ALGD_AZOVI/203-300 IAVAEMIKYTCNVWHATKVTFANEIGNIAKAAGVDGREVMEVVCMDNKLNLsQYYMRPGLAFGGSCLPKDVSALSYRAHLWDIEAP--LISSLMRSNAAQ
UDG_STRPY/197-290 ASEAEAVKLFANTYLALRVAYFNELDTYAESRKLNSHMIIQGISYDDRIG-.MHYNNPSFGYGGYCLPKDTK--QLLANYNNIPQT--LIEAIVSSNNVR
Q54365_STRLN/196-291 LTEAELVKHATNAYLGMCVSFGNELGWLAAHLGADPQVVARLLKADPRVAD.AAPLLPGAAFSGATLRRDLVALSRIGAKWGRPEF---FDTVLTVNDRH