EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00983 alignment
(9 sequences with 176 aa)


Q65665_BMDV/8-179 TVKQPSISAPGFTLSAPDGEQAGSIRQIFQFEATSVGVYETLAQVNLSSSDSLAKLTSGYRRAKVVELFLTITPTQRAIDCPVTVDVAWVPANSTAPPSKILS--IYGGQRFLIGGPITTSQIIRVPCNLQSVNAMIKDSTIYTDSPKLLVYAPIAKGSP--KTPSATVQIGGQIL
COAT_EPMV/8-179 RSPQPSINAPGFHLPPTDSQQSSAIELPFQFQATTFGATETAAQISLASANAITKLASLYRHVRLTQCAATITPTAAAIANPLTVNIVWVSDNSTAKPTEILN--VFGGSSYTFGGALNATKPLTIPLPMNSVNCMLKDSVLYTDCPKLLAYSAAPSSPS--KTPTATIQIHGKLR
COAT_BMDV/8-181 KVKQASIPAPGSILSQPNTEQSPAIVLPFQFEATTFGTAETAAQVSLQTADPITKLTAPYRHAQIVECKAILTPTDLAVSNPLTVYLAWVPANSPATPTQILKLRVYGGQSFVLGGAISAAKTIEVPLNLDSVNRMLKDSVTYTDTPKLLAYSRAPTNPS--KIPTASIQISGRIR
COAT_OYMV/8-179 KVRQPSISAPGTHLSPNPGQQSPSMVVPFQVSVSDLGVSEVSAQITLSSDPTLAQLTSIYRMASIVECEAVLFPNSTSSKNPVHCDLIWVPSNSSASPKTILQ--TYGGNRFTVGGPITSNQIISFPLRLDSVNPIIKDSVLYLDSPRLLAFSPAPPETQ--SIPSASLLIRGKLR
O09737_9VIRU/7-178 TSIQPAINTKSSDLPLQSGQHPPSVLQPFQITVASLGTKDLSDSISVAALSSIASYTTLYRHAKLTSLTATIHPNALSVSNPTTVSLVWVPYNSSATSAQILD--VYGAKRFCIGGAINTLSSIHVPCNLTNVNPIIKDSVTYTDTPKLLLSSTTIASPP--TSPTCTVTISGTIT
COAT_KYMVJ/7-178 LASQLPVNTKSSEIPLQSGTPPPTIIYPFQIEMASLGTADASDSISIASNSLLASVTTLYRHAKLTSLKATIHPTGQAPAFPTTVALAWVPYNSTATSAQILS--VYGGQMFCIGGSINSLSPIDVPCNLTNVNPIIKDSVTYSDTPKLLLYSIAQETAP--TLATCSVTITGTLT
COAT_CAYMV/7-177 LAPQPLINTKASELPSQSGSPPPEIVYPFQFTIASLGVEPTADFVSIAAQAAITAYTSLYRHAILTDLQAIIHPNGYAPAFPTSVALAWVPYNSTATAAKILD--VFGGQEFCVGGSINSTSPIIVPCPLTNINPIIKDSVTYTDTPKLLIYSTAPSYS---TSATCTLTIRGKVR
COAT_TYMV/7-178 LAPQDRTVTVATVLPAVPGPSPLTIKQPFQSEVLFAGTKDAEASLTIANIDSVSTLTTFYRHASLESLWVTIHPTLQAPTFPTTVGVCWVPANSPVTPAQITK--TYGGQIFCIGGAINTLSPLIVKCPLEMMNPRVKDSIQYLDSPKLLISITAQPTAP--PASTCIITVSGTLS
COAT_ELV/19-190 KLSQKTPVSNFSALPLPNGPQAPTQLQPFQFEFPLPAGQEGSVTLPLATFPKMATFLSRHRRAQLTQLHAVVSPSAVSIGHPLTVQLIWVPASSTTTSSQILG--TYGGQQISVGGQVTNSSPAKVSANLLMMNPHIKDSTSYTDTPKLLVYSTPAVPDDKLTTSSASIIVFGE--