EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00979 alignment
(2 sequences with 383 aa)


Q86291_9REOV/1-365 MEVCLPNGHQIVDLINNAFEGRVSIYSAQEGWDKTISAQPDMMVCGGAVVCMHCLGVV--GSLQRKLKHLPHHRCNQQIRHQDYVDVQLA--DRVTAHWKRGMLSFVAQMHAMMNDVSPDDLDRVRTEGGSLVELNWLQIDPNSMFR-SI-HSSWTDPLQVVDDLDTKLDQYWTALNLMIDSSD---LIPNFMMRDPS-HAFNGVKLEGDARQTQFSRTFDSRSSLEWGVMVYDYSELEHDPLKGR-AYRKELVTPARDFGHFGLSHYSRATTPILGKMPAVFSGMLTGNCKMYPFIKGTAKLKTVRKLVEAVNHAWGVEKIRYALG--PG---GMTGWYNRTM--QQAPIVLTPAALTMFPDTTKFGDLNYPVMIGDPMILG
O12284_9REOV/1-366 MEVRVPNFHSFVEGITSSYLKTPACWNAQTAWDTVTFHVPDVIRVGNAYCCSQCCGVLYYGTLPADGNYFPHHKCHQQQYRTDTPLLRYVRIGRTTEHLLDQYAVALESIADHYDEISQRMVD--EPENDEVAPLDIVTRTESIRSDKTVDPDFWTYPLERRSD-DSRRD-IAASCWRMIDASSRSLTLPNCLVS-PSLHSR-SVFGQMQTTTTIYD-VAASGKAVKFSPMVATLSQRDAGPVKLANADPAEGVYSFWTS-HFAFSPLIGG-VGITGQY-ARESYHHVG----HPVIGSGKKASHYRNLFMESWRGWSKSAFACATGMEPAECESRLRGHARTMLGRSLPNVCDDEVAQQSGAVLTSLQKTTKFTVVE---CG