EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00971 alignment
(3 sequences with 392 aa)


Q66731_9RETR/42-427 SKNSMAESKEARDQEMNLKEESKEEKRRNDWWKIGMFLLCLAGTTGGILWWYEGLSQQHYIGLVAIGGRLNGSGQSNAIECWGSFPGCRPFQNYFSYETNRSIHMNNNTATLLEAYHREIPFIYKSSWTDSDHCQEYQCQKVD------FNANSFYPVNESTEYWGFKWLECNQTENLKTILVPENEMVNINDSDTWIPKGCNETWARVKRCPIDILYGIHPIRLCVQPPFFLVQENGAANNSRISNCGPTIFLGVLEDNKGVIRGNSTICKVNITEIKRKDYTGIYQVPIFYTCNFTNITSCNNESIISVIMYETNQVQYLLCNKNNNSNNYNCVVQSFGVIGQAHLELPRLNKRIRNQSFNQYNCSINNKTELETWKLVKTSGITPLPIS
O36326_9RETR/42-418 SKNSMAESKEARDQEMNLKEESKEEKRRNDWWKIGMFLLCLAGTTGGILWWYEGLPQQHYIGLVAIGGRLNGSGQSNAIECWGSFPGCRPFQNYFSYETNRSMHIDNNTATLLEAYHREITFIYKSSCTDSDHCQEYQCKKVN--------------LMNTTEYWGFKWLECNQTENFKTILVPENEMVNINDNDTWIPKGCNETWARVKRCPIDILYGIHPIRLCVQPPFFLVQGKGIANTSRIGNCGPTIFLGVLEDNKGVVRGNYTACNVSRLEINRKDYTGIYQVPIFYTCNFTNITSCNNESIISVIMYETNQVQYLLCN-NNNSDHYNCVIQSFGVIGQAHLELPRPNKRIRNQSFNQYNCSINNKTELETWKLVKTSGITPLPIS
ENV_EIAV1/42-432 SKNSMAESKEARDQEMNLKEESKEEKRRNDWWKIGMFLLCLAGTTGGILWWYEGLPQQHYIGLVAIGGRLNGSGQSNAIECWGSFPGCRPFQNYFSYETNRSIHMNNNTATLLEAYHREITFIYKSSCTDSDHCQEYQCKKVNLNSSDSSNSVRVEDVTNTAEYWGFKWLECNQTENFKTILVPENEMVNINDTDTWIPKGCNETWARVKRCPIDILYGIHPIRLCVQPPFFLVQEKGIADTSRIGNCGPTIFLGVLEDNKGVVRGDYTACNVRRLNINRKDYTGMYQVPIFYTCTFTNITSCNSEPIISVIMYETNQVQYLLCN-NNNSNNYNCVVQSFGVIGQAHLELPRPNKRIRNQSFNQYNCSINNKTELETWKLVNTSGITPLPIS