EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00944 alignment
(5 sequences with 159 aa)


O41516_9VIRU/119-276 VMKLESDKTFPILL-DGKINGYACVVGGKLFRPMHVEGKIDNETLASLKTKKASKYDLEYADVPQSMRADTFKYTHDKPQGYYNWHHGAVQYENGRFTVPKGVGAKGDSGRPILDNQGRVVAIVLGGVNEGSKTALSVVMWNEKGVTVKYTPENCEQWS
POLS_EEEV/103-260 CMKLESDKTFPIML-NGQVNGYACVVGGRVFKPLHVEGRIDNEQLAAIKLKKASIYDLEYGDVPQCMKSDTLQYTSDKPPGFYNWHHGAVQYENNRFTVPRGVGGKGDSGRPILDNKGRVVAIVQGGVNEGSRTALSVVTWNQKGVTVKDTPEGSEPWS
P89946_BFV/98-255 CMKIENDCIFPVML-DGKVNGYACLVGDKVMKPAHVKGTIDNPELAKLTFKKSSKYDLECAQVPVCMKSDASKFTHEKPEGHYNWHHGAVQFSNGRFTIPTGSGKPGDSGRPIFDNTGKVVAIVLGGANEGARTALSVVTWNKDMVTRITPEESVEWSA
P89913_SINDV/109-267 ALKLEADRLFDVKNEAGEVIGHALAMEGKVMKPLHVKGTIDHPVLSKLKFTKSSAYDMEFAQLPTNMRSEAFSYTSEHPEGFYNWHHGAVQYSGGRFTVPKGAGGKGDSGRPIMDNTGKVVAIVLGGADEGARTALSVVTWNSKGKTIKTTPEGTEEWS
Q86925_9VIRU/110-268 ALKFEADRTFVGKNEDGKIMGYAVAMEGKVIKPLHVKGTIDHPALAKLKFTKSSSYDMEFAKLPTEMKSDAFGYTTEHPEVFYNWHHGAVQFSGGRFTIPTGVGGPGDSGRPILDNSGKVVAIVLGGANEVPGTALSVVTWNKKGAAIKTTHEDTVEWS