EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00932 alignment
(24 sequences with 127 aa)


Q25421_LUMTE/476-593 EMSVKTTYQKSAKGPVAIYECSQDGKTVALENTGR-..-KDELKGNWSLTRNIDGKD--VATYKFSDSFVLRPGQKIKGWAKGTRPFTGASG--DIESDQNWES-SHIITKLVNPLGEDRATHIQQT
Q25089_HAEMA/476-595 LVGGRTSYQRNARGPVSIAECSPDGKFVILENTGK-..-RREELGGFTLRRKVDGKD--VPVYTFKADAGIDPHMKIKLWVKGAKPSNATAS-DIEVDILDWGTGQNITTQLFNTSGQDRASHIQKT
Q25017_HELAS/518-642 EVSAKTTYQRTANGPVSIAEANPEGKFILIENNSSGgvRKEVNLDGWKLQRIVDNNVKKPYVYTFR-NFVLKPSKNVKIFARSLA-SQAGPNDLVFRDADTWGAGAEVVTTLINEKGEEKASHIQKT
NF70_LOLPE/496-612 ELAAKTTYQRTSKGSVSIKEADSQGCFIALET----..KKEENLTGWKIVRKVDDN--KVYTYEIP-NLVLKTGTVVKIWSKNHQ-AQARGDDLVSRENDTWGTGSNVVTILQNEKGEDKANYTQNT
Q17050_9BILA/483-604 ETTSKIHYHATAKGNLSIQDASVDGKFIVIENTSPT..-KEENIGEWQIKRSADNG--PEVVFTFPKGFILKPLKTVKIWARDQGGEDKPPDQLIFEKEDSFGFGSNAKTVLINASGEERASHLQTT
Q17048_9BILA/507-628 ETSSRTSYTRSAKGNVSIQETSPDGKYIVLENTHRS..-KEEPIGEWKLKRKIDGK--KEIVYTLPKDFILKPCKHVKIWARGQGGIHAPPEQLIFEGEDSFGVGSNVQTILYNREGEERATHIQRS
AV71_ACAVI/269-389 ETASRTSFQRSAKGNVSIQDAASDGKYILSENTHRS..-KEEPIGEWRLKRKIDGK--REIVYTFPTNFVLKPGKSVKIWARGQG-VYSPPDQLVFDAEDSFGIGSNVQTILFNKEGEERASHIQRS
IFA1_CAEEL/452-572 ETASRQSFQRSAKGNVSIHEASPDGKFIVLQNTHRA..-KDEAIGEWKLKRRIDGK--RENVYTLPRDFVLRAGKTLKIFARNQG-VASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQRQ
IFA2_CAEEL/454-574 EHSSRTSYQRSAKGNVAIKETSPEGKFVILENTHRA..-KEEPLGDWKLKRKIDGK--REIVFTFPSDYILHPFQSVKIFARGQG-IANPPEVLIFEGDETFGVGANVQTILYNNKGEERATHIQRQ
IFA4_CAEEL/453-572 ETTSHSSYSRSAKGNIAIQEAEPSGKYIVLENISR-..-RDENIGDWKLRRKIAGK--REIVFTFPREFTLRAQKSVKIFARGQG-VHSPPDSLVYDLEDSFGTGNDVVTTLYNKEGEDRASHSQRA
IFEB_ASCSU/463-584 EVSTKTTFQRSAKGNVTISECDPNGKFITLENTHRS..-KDENLGEHRLKRKLDNR--REIVYTIPPNTVLKAGRTMKIYARDQGGIHNPPDTLVFDGENTWGIGANVVTSLINKDGDERATHTQKT
IFB2_CAEEL/417-538 EVQTRSSFKRHAKGNVSIVECDPQGKYIILENTSGS..-VAEDVSNFEIRRVIDGVQ--AFVFRLPSHLVIQQHGHLKIYGRNSGGINSPPDSIVMESHPSWGQGGQVETFLYNSHGIEKASHIQTT
LAMC_DROME/465-582 RTLSEYSVNAAAKGDLEIIEADVEGRFIKLHNKGT-..-EEINLTGWQLTRIAGDEE---LAFKFSRGSKILGGASVTIWSVDAGTAHDPPNN--LVMKKKWPVANSMRSVLANADKEDVASYDRVR
LAM0_DROME/458-578 HSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGS-..-EEVAIGGWQLQRLINEKG-PSTTYKFHRSVRIEPNGVITVWSADTKASHEPPSS-LVMKSQKWVSADNTRTILLNSEGEAVANLDRIK
LAMA_XENLA/422-542 SRSSSFTQHARTTGKVSVEEVDPEGKYVRLRNKSN-..-EDQSLGNWQIKRQIGDETP--IVYKFPPRLTLKAGQTVTIWASGAGATNSPPSDLVWKAQSSWGTGDSIRTALLTSSNEEVAMRKLVR
LAMA_HUMAN/425-545 ESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSN-..-EDQSMGNWQIKRQNGDDPL--LTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLVR
LAMA_CHICK/426-546 EGRTSFSHHARTSGRVGVEEVDLEGRFVRLRNKSN-..-EDQALGNWQVKRQNGDDPP--LTYRFPPKFTLKAGQAVTIWASGAGATHSPPSDVVWKAQSSWGSGDSLRTALINSNGEEVAMRKLVR
LAML2_XENLA/465-585 TTRFHLSQQASATGSISIEEIDLEGKYVHLKNNSD-..-KDQSLGNWRLKRKIGEEEE--IVYKFTPKYVLKAGQSVKIYSADAGVAHSPPSILVWKNQSSWGTGSNIRTYLVNTEEEEVAVRTVTK
LAM2_CHICK/442-562 SSSFQMSQQASATGSISIEEIDLEGKYVQLKNNSE-..-KDQSLGNWRLKRQIGDGEE--IAYKFTPKYVLRAGQTVTIWGADAGVSHSPPSVLVWKNQGSWGTGGNIRTYLVNSDGEEVAVRTVTK
LAM2_MOUSE/435-551 SRLAQT----VATGVVNIDEVDPEGRFVRLKNSSD-..-KDQSLGNWRIKRQVLEGED--IAYKFTPKYVLRAGQTVTVWAAGAGATHSPPSTLVWKSQTNWGPGESFRTALVSADGEEVAVKAAKH
LAML1_XENLA/426-545 SSSVSIDHSAAATGDVSIEEVDVDGKYIRLKNNSE-..-KDHPLGGWELTRTIGEAS---VNFKFTSRYVLKAEQTVTIWAADAGVKASPPSDLIWKNQNSWGTGEDVKATLKNSQGEEVAQRTTIY
LAM1_CHICK/426-545 SSSVSISHSASATGNISIEEIDVDGKFIRLKNTSE-..-QDQPMGGWEMIRKIGDTS---ASYRYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVVLKNSQGEEVAQRSTVF
LAML3_XENLA/426-546 KRSYKVVQQASSTGPVSVEDIDPEGNYVRLLNNTE-..-EDFSLHGWVVKRMHMSLPE--IAFKLPCRFILKSSQRVTIWAAGAGAVHSPPTDLVWKSQKTWGTGDNIKITLLDSTGEECAERTLYR
LMN1_CAEEL/434-550 NRRSKL--NKETVGPVGIDEVDEEGKWVRVANNSE-..-EEQSIGGYKLVVKAGNKE---ASFQFSSRMKLAPHASATVWSADAGAVHHPPEVYVMKKQQ-WPIGDNPSARLEDSEGDTVSSITVEF