EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00908 alignment
(19 sequences with 185 aa)


O33707_STRPE/3-179 ARELAVQGAYTFEPEVFPDERGLFVSPFREDAFTAAVGHPLFPVRQTNHSRSRRGVVRGVHYTVTPPGSAKYVYCARGRSLDIVVDVRVGSPTYGRWDAVELEPREFRAVYFPVGVGHAFVALEDD.TVMSYMLSGEYVQANELAVSVLDPALGLPVP--GDLEP-...-LLSGRDRAAPPLEQA
STRM_STRGR/1-175 MRPLSVQGAWLSETRAFADDRGEFQELYSARSLRGALGYDPG-VAQVNRSVSRRGVLRGVHFAQLPPSQAKYVTCLSGAVLDVVVDIRTGSPTYRAWEAVRLDDPHR-SLYVEAGLGHSFMALTDD.AVVVYLTSQGYAAGREHGVHPLDPDLGIAWP--DGIEP-...-VLSEKDRQAPGIAEM
O06330_MYCTU/3-180 ARELDVPGAWEITPTIHVDSRGLFFEWLTDHGFRAFAGHSLD-VRQVNCSVSSAGVLRGLHFAQLPPSQAKYVTCVSGSVFDVVVDIREGSPTFGRWDSVLLDDQDRRTIYVSEGLAHGFLALQDN.STVMYLCSAEYNPQREHTICATDPTLAVDWPLVDGAAP-...-SLSDRDAAAPSFEDV
Q57502_YERPS/12-182 FKKLDIEGCYLIEFNKFIDSRGTFVKTFHSDFFSENGIVL-DMREEFYSISAK-NVIRGMHFQMPPAEHDKLVYCVNGAVLDVILDIRKDSKTYGEYFSIELSYENSLALWVPKGLAHGFLSLADN.SIMFYKTSSVHNVECDSGIKWN--SFGFKWPIDN-----...PIISEKD-NSLCYFDE
Q54202_STRGA/3-177 IHETPLAGAALIELSELRDERGFFSRSFCREEFERAGLEP-AVVQCNLSFNHRAGSLRGFHYQTEPNAEAKTIRCTRGAIYDVIVDLRPDSPTFLRHFGAELTADNRLALHVPRNFAHAYLTLADD.TETVYQVSAAYTPGAERGLRWNDPALGVEWPAPVK-L--...--VSDKDAGWPLLSEV
P72887_SYNY3/9-183 TEDLGIAGLRTVIRQPIGDRRGFLARLFCAEELKEVGWHK-PIAQINHTHTAQGGTVRGMHYQNPPSAEMKLVTCIRGQVWDVAVDLRVDSPTFLTWQGVVLSADNNRALLIPEGCAHGFQALSDD.VELIYCHSVAYNPMAEGGLNPQDPRLGIEWPQAIT-E--...--LSQRDQNHPLLDST
Q17993_CAEEL/15-190 EVIEAIPDLLVIKPKVFPDERGFFSESYNKTEWAEKIGYTEDLQQDNHSFSHY-GVLRGLHTQPHM---GKLVTVVSGEIFDVAVDIRKDSPTYGKWHGVVLNGDNKHAFWIPAGFLHGFQVLSKEgAHVTYKCSAVYDPKTEFGINPFDEDINVDWPIRDKTVVI...--VSERDTQHASFKSL
Q56904_YEREN/3-184 CTKLSIPEVILFEPRIFEDDRGHFFESFNLAKFQESIGRQVTFVQSNESYSKQ-NVIRGLHYQVIR-PQGKLVRVVEGEVFDIAVDLRKSSPTFGQWVGVLLSDKNNHQLWIPEGFGHGFQVLSPS.AKFQYMVTDYWYPEHDRCIRFNDSDINIKWKEGIISEQQvieYKLSSKDISGNSLADA
RFBC_ECOLI/3-178 VIRTEIEDVLILEPRVFGDDRGFFYESFNQSAFEHILGYPVSFVQDNHSRSSK-NVLRGLHFQRGEYAQDKLVRCTHGAVFDVAVDIRPNSVSFGKWVGVLLSADNKQQLWIPKGFAHGFLVLSDI.AEFQYKTTNYYHPESDCGICWNDERIAIDWPQTSGLILS...---P-KDERLFTLDEL
RFBC_SALTY/4-179 VIKTAIPDVLILEPKVFGDERGFFFESYNQQTFEELIGRKVTFVQDNHSKSKK-NVLRGLHFQRGENAQGKLVRCAVGEVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAHGFVTLSEY.AEFLYKATNYYSPSSEGSILWNDEAIGIEWPFSQLPELS...---A-KDAAAPLLDQA
RFBC_SHIFL/3-177 VIKTEIPDVLIFEPKVFGDERGFFMESFNQKVFEEAVGRKVEFVQDNHSKSTK-GVLRGLHYQLEPYAQGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHGFCVLSDE.AEFVYKTNNFYSKMQERGILWSDKSINIEWPVQN-PLLS...---D-KDINGQKFVDA
P74488_SYNY3/3-177 VIPTTIADVLILEPKVFGDERGFFFESYNDKVFQQAVGIEPHFVQDNHSFSRQ-GVVRGLHYQIQH-PQGKLVRVARGEIFDVAVDLRRNSPSFGQWVGCVLNDHNKRQLWIPAGFAHGFAVLSPE.AEVLYKATDYYAPSYERTLLWNDPAIGIDWSLTTTPL--...--LSLKDQRGLPLAEA
RFBC_NEIGO/3-176 IIDTALPDVKLLKPQVFTDGRGFFMETFRDGWFKENIADR-TFVQENHSNSSK-GVLRGLHYQTEN-TQGKLVRVVVGEVFDVAVDMREGSPTFGKWAGATLSAQNRYQLWIPEGFAHGFCVLGDA.AEVVYKCTDYYNPETEQVLIWNDPAIGIGWPLQTAPL--...--LSPKDLAGKTWAQA
O27818_METTH/6-176 FIKTSLDGAIIIEPEVYTDERGYFMETFNEAIFQENGLEV-RFVQDNESMSVR-GVLRGLHFQREK-PQGKLVRVIRGEIFDVAVDLRKNSDTYGEWTGVRLSDENRREFFIPEGFAHGFLALSDE.CIVNYKCTELYHPEYDSGIPWDDPDIGIDWPLEMVDDLI...--ISEKDR-----NWK
Q56809_XANCP/3-175 VIETTLPGCVVIEPAVFGDERGQFFETWNAERFGQHGLPT-SFVQSNVSTSAR-GVLRGLHYQWPR-PQGKLVSVLEGEVYDVAVDIRAGSPHFGRWTAVLLSAENRRQVWIPEGFAHGFAVLSEK.ALFSYLCTDVYVKEADAGVRWDDAAIGIDWPVSD-----...PSLSAKDAKAPFLDEV
RFBC_RHISN/11-186 FQSLSIAEVKLIRPRKFGDCRGYFSEVFREKWFRKNVADV-GLVQDNESLSAQIGTVRGLHFQLEPFAQGKLVRCTRGALFDVAVDVRVGSPTYGKWVSAELSQENGAQLWVPAGFAHGFMTLKAD.TVISYKVTAPYSAEHDRGLKWDDPAIGINWPKMTT----...YVLSEKDSSQPSLCEL
P96449_RHIME/4-180 VRSLGLDGVLEIVPRRLGDERGFFSETYNAETLAAHGVAA-IFVQDNHSYSAAAGTLRGLHYQLPPKAQAKLVRVVRGRVFDVVVDIRKGSPTFAKWVALELSAEKWNQILVPVGFAHGLVTLDPE.TEVLYKVSEHYSAEHERSIRYDDPEIGIGWPAATDR---...LQLSAKDRNAPLLHES
P74831_9SPHN/4-180 VHHHALSGVIEFTPPKYGDHRGFFSEVFKQSTLDAEGVEA-RWVQDNQSFSAAPGTIRGLHLQAPPFAQAKLVRVLRGAIYDVAVDIRRGSPTYGQWVGVELSADKWNQLLVPAGYAHGFMTLVPD.CEILYKVSAKYSKESEMAIRWDDPDLAITWPDIGVE---...PVLSEKDAVATPFAEF
P71436_LEPIN/3-180 FKKFQIEGPVLIEPKVFGDERGFFLETFKASIFEKENIPF-QFSQDNHSRSSR-GVLRGMHLQIPPYDQGKLVRVVRGKVIDVVVDVRVGSPNYGKWLSVELSEENKNIFWVPPGFAHGFLTLEDK.TDFLYKVTGEYSPQNEVGIRWDDPALGIPWKTWLSDSE-...FIVSQRDQVTPFFADF