EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00862 alignment
(4 sequences with 551 aa)


SUS1_DAUCA/7-556 TRVHSLRERMDSTLANHRNEILMFLSRIESHGKGILKPHQLLAEYEAIS.KEDKLKLDDGHGAFAEVIKSTQEAIVSPPWVALAIRLRPGVWEYVRVNVHHLVVEELSVPQYLQFKEELVIGSSDANFVLELDFAPFTASFPRPTLTKSIGNGVEFLNRHLSAKMFHGKDSMHPLLEFLRLHNYNGKTLMLNNRVQNVNGLQSMLRKAGDYLSTLPSDTPYSEFEHKFQEIGFERGWGDTAERVTEMFHMLLDLLEAPDASTLETFLGKIPMVFNVVILSPHGYFAQENVLGYPDTGGQVVYILDQVPALEREMIKRIKEQGLDIKPRILIVTRLLPDAVGTTCNQRLEKVFGAEHAHILRVPFRTEKGILRKWISRFEVWPYIETFTEDVAKEIALELQAKPDLIIGNYSEGNLVASLLAHKLGVTQCTIAHALEKTKYPDSDIYWEKFDKKYHFSSQFTADLIAMNHTDFIITSTFQEIAGSKDTVGQYESHTAFTMPGLYRVVHGIDVFDPKFNIVSPGADTSVYFSYKEKEKRLTTLHPEIEELLYS
SUSY_SOYBN/7-554 TRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIP.EENRQKLTD--GAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVEELQPAEYLHFKEELVDGSSNGNFVLELDFEPFNAAFPRPTLNKSIGNGVQFLNRHLSAKLFHDKESLHPLLEFLRLHSVKGKTLMLNDRIQNPDALQHVLRKAEEYLGTVPPETPYSEFEHKFQEIGLERGWGDNAERVLESIQLLLDLLEAPDPCTLETFLGRIPMVFNVVILSPHGYFAQDNVLGYPDTGGQVVYILDQVRALENEMLHRIKQQGLDIVPRILIITRLLPDAVGTTCGQRLEKVFGTEHSHILRVPFRTEKGIVRKWISRFEVWPYLETYTEDVAHELAKELQGKPDLIVGNYSDGNIVASLLAHKLGVTQCTIAHALEKTKYPESDIYWKKLEERYHFSCQFTADLFAMNHTDFIITSTFQEIAGSKDTVGQYESHTAFTLPGLYRVVHGIDVFDPKFNIVSPGADQTIYFPHTETSRRLTSFHPEIEELLYS
SUS2_TULGE/7-555 TRVHSVRERLTDTLSAHKNELLALFSRFVKQGQGMLQPHQLLTEYEAVIpAADREKLKD--GVFEDVLKAAQEAIVIPPWVALAIRPRPGVWEYVRVNVSELAVEELTVPEYLQFKEELVDGSGQSNFTLELDFEPFNASFPRPSLSKSIGNGVQFLNRHLSSKLFHDKESMYPLLNFLKEHHYNGTSMMLNDRIQTLGALQASLRRADEYVLSLPLDTPYSDFGHRFQELGLEKGWGDNAKRVHENLHLLLDLLEAPDPCTLENFLGTIPMVFNVVILSPHGYFAQANVLGYPDTGGQVVYILDQVRAMESEMLLRIKQQGLDITPRILIVTRLLPDAVGTTCGQRLEKVLGTEHTHILRVPFRTEHGILRKWISRFEVWPYLETYAEDVANEVAGELQATPDLIIGNYSDGNLVASLMAHKLGVTQCTIAHALEKTKYPNSDLYWKKFEKQYHFSCQFTADLIAMNHADFIITSTFQEIAGSKDTVGQYESHTGFTLPGLYRVVHGIDVFDPKFNIVSPGADMSIYFPYTEAEKRLTALHPEIEELLYS
SUS2_PEA/8-557 TRVPSIRDRVQDTLSAHRNELISLLSRYVAQGKGILQPHNLIDELDNIL.GEDHATLDLKNGPFGQIINSAQEAIVLPPFVAIAVRPRPGVWEYVRVNVFELSVEQLSVSEYLSFKEELVEGKSNDNIILELDLEPFNASFPRPTRSSSIGNGVQFLNRHLSSNMFRNKDCLEPLLDFLRVHTYKGHALMLNDRIQSISKLQSALVKAEDHLSKLAPDTLYSEFEYELQGTGFERGWGDTAARVLEMMHLLLDILQAPDPSTLETFLGRVPMVFNVVILSPHGFFGQANVLGLPDTGGQVVYILDQVRALESEMLVRIKKQGLDFTPRILIVTRLIPDAKGTTCNQRLERVSGTEYTHILRVPFRSEKGILRKWISRFDVWPFLETFAEDVASEIAAELQCYPDFIIGNYSDGNLVASLLAYKMGVTQCTIAHALEKTKYPDSDIYWKKFEDKYHFSCQFTADLIAMNNADFIITSTYQEIAGTKNTIGQYESHTAFTLPGLYRVVHGIDVFDPKFNIVSPGADMTIYFPYSDKEKRLTALHSSIEKLLYG