EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00859 alignment
(3 sequences with 300 aa)


Q91800_XENLA/210-501 QESFVTSGVFSVTELIQVSRTPVVSGTGPNFSLGELQGHLAYDLNPTGTGMRRTLPSTSSSGSKRHKSGSMEDDIDTSPGGEYYTSPSSPTGSNRNWTEDVEGGMSPTVKKSELDKSPFHSPSPQDISPRISSFTQHHRP---VIAVHSGLARSPHTSTTLHFPTSSLLPQ-ASTYFPHTAIRYPPHLNPQDPLKDLVSLACETSSQQPGPLNGSGQVKVSSHYISTQMLAPPPPGMPRLSLSSDTKSTTASDGSTSSPTSPTYSAPSTPPTNRSFVGLGPREPGSIYQAQS----WYLG
NFIC_HUMAN/217-508 QESFVTSGVFSVTELIQVSRTPVVTGTGPNFSLGELQGHLAYDLNPASTGLRRTLPSTSSSGSKRHKSGSMEEDVDTSPGGDYYTSPSSPTSSSRNWTEDMEGGISSPVKKTEMDKSPFNSPSPQD-SPRLSSFTQHHRP---VIAVHSGIARSPHPSSALHFPTTSILPQTASTYFPHTAIRYPPHLNPQDPLKDLVSLACDPASQQPGPLNGSGQLKMPSHCLSAQMLAPPPPGLPRLALPPATKPATTSEGGATSPTSPSYSPPDTSPANRSFVGLGPRDPAGIYQAQS----WYLG
NFIB_CHICK/209-497 EDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGELPSQPYYHDMNSGINLQRSLSSPPSS--KRPKTISIDENMEPSPTGDFYPSPNSPAAGSRTWHERDQDMSSPTMKKP--EKPLFSPTSPQDSSPRLSTFPQHHHPGIPGVAQSVISTRTPPSPSPLPFPAQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVP-SYDPSSPQTSQPNSSGQVVGKVPGHFTPVLAPSP---HHSAVRPVTLTMTDTKPITTS--TEAYTASGTSQANR-YVGLSPRDPSFLHQQQLRICDWTMN