EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00832 alignment
(10 sequences with 43 aa)


RL39_KLUMA/8-50 IKQKLAKAKNQNRPLPQWFRLKTNNTIRYNAKRRHWRRTKLVC
RL39_DROME/9-51 IKQKLAKKLKQNRSVPQWVRLRTGNTIRYNAKRRHWRRTKLKL
RL39_ARATH/9-51 IKKKLGKKMRQNRPIPHWIRLRTDNTIRYNAKRRHWRRTKLGF
RL39_SCHPO/8-50 TKQKLAKAARQNRPIPQWIRLRTGNTVHYNMKRRHWRRTKLNI
RL39_RAT/8-50 IKRFLAKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWRRTKLGL
RL39_HALMA/7-49 TKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE
RL39_SULAC/8-50 KKLRLGKALKRNSPIPAWVIIKTQAEIRFNPLRRNWRRNNLKV
RL39_ARCFU/8-50 VKKRLAKAYKQNRRAPVWITVKTKRSVFGSPKRRHWRRSKLKV
RL39_METTH/9-51 RKLRMAKANRQNRRVPAWVMVKTNYRVRSHPKMRHWRRTKLKV
RL39_METJA/9-51 KKVRLAKALKQNRRVPLFVIVKTRGRVRFHPKMRYWRRKKLKA