EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00802 alignment
(4 sequences with 261 aa)


VGLG_ORSVW/10-251 FKTLKKAWKASKYFIVGLSCLYKLNLKSLVQMALSALAMITLVSLTITAIIYISTGNTKAKPMPTPTIQITQQFQNHTSLPPTEHNHNSTHSPTQGTTSPHTFAVDVTEGTRYYHLTLKTQGGKTKGPPTPHATRKPPISSQKSNPSEIQQDYSDFQILPYVPCNICEGDSACLSLCQDRSESILDKALTTTPKKTPKPMTT-----------------KKPTKTSTHHRTS--LRNKLYIKTNMTTPPHGLISTAKHNKN
VGLG_BRSVL/10-251 LKTLKRAWKASKYFIVGLSCLYKFNLKSLVQTALTTLAMITLTSLVITAIIYISVGNAKAKPTSKPTIQQTQRPQNHTSPLFTEHNYKSTHTSIQSTTLSQLLNIDTTRGTTYSHPTDETQNRKIKSQSTLPATRQPPINPSGSNPPENHQDHNNSQTLPYVPCSTCEGNLACSSLCQIGLERAPSRAPTITLKKAPKPKTT-----------------KKPTKTTIHHRTS--PEAKLQPKNNTAAPQQGILSSPEHHTN
O36633_HRSV/10-270 ARTLEKTWDTLNHLIVISSCLYRLNLKSIAQIALSVLAMIISTSLIIAAIIFIISANHKVTLTTVTVQTIKNHTEKNITTYLTQVPPERVSSSKQPTTTSPIHTNSATTSPNTKSETHHTTAQTKGRTTTSTQTNKPSTKPRLKNPPKKPKDDYHFEVFNFVPCSICGNNQLCKSICKTIPSNKPKKKPTIKPTNKPTTKTTNKRDPKTPAKTTKKETTTNPTKKPTLTTTERDTSTSQSTVLDTTTLEHTIQQQSLHSTT
O09634_HRSV/10-269 AKTLEKTWDTLNHLLFISSCLYKLNLKSIAQITLSILAMIISTSLIIAAIIFIASANHKVTLTTAIIQDATSQIKNTTPTYLTQNPQLGISFSNLSETTSQTTTILASTTPSVKSTLQSTTVKTKNTTTTKIQPSKPTTKQRQNKPPNKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTIKTT-KKDLKPQTTKPKEVPTTKPTEKPTINTTKTNIRTTLLTNNTTGNPEHTSQKGTLHSTS