EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00797 alignment
(10 sequences with 263 aa)


NHOA_SALTY/21-257 TVEALRTLHLAHNCAIPFENLDVLLPREIQLDETALEEKLLYARRGGYCFELNGLFERALRDIGFNVRSLLGRVILSHPASLPPRTH-RLLLVDVEDEQWIADVG-FGGQ-TLTAPLRLQAEIAQQTPHGEYRLMQEGSTWILQFRHHEHW-----------------QSMYCFDLGVQQQSDHVMGNFWSAHWPQSHFRHHLLMCRHLPDGGK----LTLTNFHFTRYHQGHAVEQVNVPDVPSLYQLLQQQFG--LGVNDV
ARYL_CHICK/20-281 DLQTLTAIFQHHIQAIPFENLSMHCGETIDLDLQATYNKIVKKKRGGWCMETNYLLFWALKEMGYDICVLGGNSYEPAKKAYTDEINHILLKVVIKGSSYIVDAGFGGGPYQTWLPMLLISGKDQPQIPGIFRFIEDNGIWYLEKVKRKHYVPEGSVPLTDNPEMGNIRKLYSFTLEPKHIDDFQELNAYLQVAPDTILQKKSICSLQTTDGFYALVGWTFSEMKYKYKEDADLLQTTTLTD-EEVEKTLKDKFNIVLENKLI
ARY2_CHICK/20-280 DLETLTEIFQHHIQAVPFENLSIHCGETIELDLAATYDKIVRKKRGGWCMENNHLLSWALKTLGYNVTLLGAKVYIPEHDAYADDID-HLLLKVVLHDKSYIVDGGFGMAYQLWQPMELISGKDQPQTPGIFRFVEENGTWYLEKVKRKQYVPNHSDSAPHNVDKEVCRRVYLFTLQPRDIEEFRARNLHLQTAPDSLFVTKSICSLQTPDGVRALVGWKLTEIKYNYKDNMDLVEIRILAD-EEMEKTLKEKFNITLDKKFV
ARY1_CHICK/20-280 DLETLTDIFQHHIRAVPFENLSIHCGEKITLELEHVYNKIVHKKRGGWCMENNQLLGWVLKCLGYDTSFLG-AYVFNPHENAYATIMTHLLVKVVIEGKAYIVDAGFGVSYQMWQPMELVSGKDQPQAPGIFRFTEKNAIWYLEKMRRKQYIPNQNFSNSDLLEKKDCRKVYMFSLEPRTVEDFCFQCTYLQTSPDSLFTKKSICTLQTTDGFRALIGWTLTETKYNYKENMDLVEFITLKD-EEVEKTLKDKFNITLERKLV
ARY3_MOUSE/20-280 DLQTLTEILQHQIRAIPFENLNIHCGKTMELSLEDTFHQIVRKKRGGWCLQVNHLLYWALAMIGFETTMLGGCVYVPSACKYSNTMIHLLLQVTISGKTYIVDSA-FPFSCQLWEPLELTSGKDQPQVPAIFHLREENGTWYLEQTKRQEYVSNQEFIDSNFLEKNTHRKIYSFTLEPRTIEDFWSISTYYQVSRTSVMTNTSLCSLHTKDGVHGLMGTILAYKKFNYKDNIDLVEFKTLKE-EEIEEVLKSVFGIHLETKLV
ARY2_MESAU/20-280 DLQTLTEILQHQIRAIPFENLNIHCGESMELSLETIFDQIVRKKRGGWCLQVNHLLYWALTKMGFETTMLGGYVFNTPANKYSSGMI-HLLVQVTISDRNYIVDAGFGRSLQMWEPLELVSGKDHPQVPAIFRLTEENETWYLDQIRREQYVPNQAFVNSDLLEKNKYRKIYSFTLEPRTIEDFESMNTYLQTSPASVFTSKSFCSLQTPEGVHCLVGCTLTYRRFSYKDNVDLVEFKSLKE-EEIEDVLKTIFGISLEKKLV
ARY1_HUMAN/20-280 DLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALTTIGFETTMLG-GYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSE-EEIEKVLKNIFNISLQRKLV
ARY1_MESAU/20-280 DLATLTEVLQHQMRTIPFENLNMHCGEAMDLGLEATFDQIVRKKRGGWCLQVNHLLYWALTQMGFETTMLG-GYVYIVPVSKYSSEMIHLLVQVTISDRNYIVDAAYGGSYQMWEPVELASGKDQPQVPAIFRLTEENETWYLDQIRREQHVPNQEFVNSDLLEKNTYRKIYSFTLQPRTIEDFEYANTYLQISPVSVFVNTSFCSLQTSEGVCCLIGSTIARRKFSYKENVDLVEFKNVSE-EEIEDVLKTAFGVSLERKFV
ARY1_RABIT/20-280 DLESLTDIFQHQIRTVPYENLSIHCGESMELDLEAIFDQIVRRNRGGWCLQVNYLLYWALTTTGFETTMLG-GFVCGSHTDKYSTGMIHLIVQVTINGRNYIVDAGFGRSYQMWQPVELISGKDQPQVPSIFRLREEGETWYLDQIRRQQHVPDQEFLNSELLERKTHRKLYCFTLQPRTIEEFESANTYLQISPSSPFLDKSICSLQTPEGVHCLVGLILTFRTYNYKENTDLVEFKVLTE-EEVEEVLKTIFNISLGKKLV
ARY2_HUMAN/20-280 DLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIVRRNRGGWCLQVNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYIVDAG-SGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFNYKDNTDLVEFKTLTE-EEVEEVLKNIFKISLGRNLV