EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00770 alignment
(13 sequences with 183 aa)


ADEN_ADEM1/19-201 SFLGIFDKHFPGFISVNKPACAIVNTASRETGGVHWLAMAWYPTSSTFYLFDPFGFSDRKLQQVYKFEYERLLKRSAVSSSSSKCVTLVKSHQTVQGPHSAACGLFCVLFLAAFGKYPQNPMNNNPIMGPIEGVPNDQMFNPCYTKTLYRNQQWVYSYLNKNSLYFRLHVELIKKNTAFDKLL
ADEN_ADEB3/20-202 YFLGTFDKHFPGFISKDRMSCAIVNTAGRETGGVHWLAMAWHPASQTFYMFDPFGFSDQKLKQIYNFEYQGLLKRSALTSTADRCLTLIQSTQSVQGPNSAACGLFCCMFLHAFVRWPLRAMDNNPTMNLIHGVPNNMLESPSSQNVFLRNQQNLYRFLRRHSPHFVKHAAQIEADTAFDKML
ADEN_ADE40/20-202 YFLGTFDKRFPGFMAPHKLACAIVNTAGRETGGVHWLALAWNPKNRTCYLFDPFGFSDERLKQIYQFEYEGLLKRSALASTPDHCITLIKSTQTVQGPFSAACGLFCCMFLHAFVNWPTSPMERNPTMDLLTGVPNSMLQSPQVVPTLRHNQERLYRFLAQRSPYFQRHCERIKKATAFDQMK
ADEN_ADE03/26-207 YFLGTFDKRFPGFMAPDKLACAIVNTAGRETGGEHWLAFGWNPRYNTCYLFDPFGFSDERLKQIYQFEYEGLLRRSALA-TKDRCITLEKSTQSVQGPRSAACGLFCCMFLHAFVHWPDRPMDGNPTMKLVTGVSNSMLQSPQVQPTLRRNQEVLYRFLNTHSSYFRSHRARIERATAFDRMD
ADEN_ADE12/20-202 YFLGTFDKRFPGFVSRDRLSCAIVNTAGRETGGVHWLAFGWNPKSHTCYLFDPFGFSDQRLKQIYQFEYESLLRRSALAATKDRCVTLEKSTQTVQGPFSAACGLFCCMFLHAFTHWPDHPMDKNPTMDLLTGVPNCMLQSPQVVGTLQRNQNELYKFLNNLSPYFRHNRERIEKATSFTKMQ
ADEN_ADE02/20-202 YFLGTYDKRFPGFVSPHKLACAIVNTAGRETGGVHWMAFAWNPRSKTCYLFEPFGFSDQRLKQVYQFEYESLLRRSAIASSPDRCITLEKSTQSVQGPNSAACGLFCCMFLHAFANWPQTPMDHNPTMNLITGVPNSMLNSPQVQPTLRRNQEQLYSFLERHSPYFRSHSAQIRSATSFCHLK
ADEN_ADEB2/20-200 YFLGTFDKRFPGFLHKDKLSCAIVNTAARETGGAHWLALAWFPNAKNFYFFDPFGFSDHKLKQIYQFEYEGLLRRSALA--GDGCVNLVKSTETVQGPNSAACGLFCCMFLHAFVNWPDRPMTRNPTMDLLTGVPNADMMKPSSLAILRENQNQLYKFLSTHSQYFRTHRPQIERDTSFNKLL
ADEN_ADECT/23-205 FFLGTFDKRFPGFISSQRMACAIVNTAGRETGGVHWLAMAWNPRSKTFYMFDPFGFSDSKLKQVYSFEYEGLLRRSAIASSPDRCVTLAKSNETIQGPNSAACGLFCCMFLHAFVNWPDDPFDHNPTMGPLKSVPNYKLNDPTVQYVLWGNQEKLYKFLEKHSAYFRAHAAAIKARTAFNKLK
ADEN_ADEP3/19-201 RFLGTFDKSFPGFLQESQRCCAIVNTAARHTGGRHWLAVAWEPASRTFYFFDPFGFSDRELAQVYDFEYQRLLRKSAIQSTPDRCLTLVKSTQSVQGPHSAACGLFCLLFLAAFARYPDSPMAYNPVMDLVEGVDNERLFDADVQPIFRANQEACYAFLARHSAYFRAHRHAIMEQTHLHKAL
ADEN_ADEE2/20-201 LLLGTYDKRFPGFVSKAKP-CPIVNTAFGETGGEHWIAMAWYPPNNSFYMFDPFGFSDQKLKQIYDFEYQGLLRRSALTSSKDRCVQLIRSTDTVQGPNSAGCGLFGGLFLKSFACNPARPRNGNPIIDIVRGVPNERFTDPSSLPILYRNQENMYAFLENNSPYFVSHEREIKRKTAFDYIQ
ADEN_ADEB7/21-199 GFLGTFDCRFPGFINKVKVQTAIINTGPREQGGIHWIALAWDPKSYQMFIFDPLGWKNDQLMKYYKFSYSNLIKRSALS-SPDKCVKVIKNSQSVQCTCAGSCGLFCVFFLYCFYKYKSNAFKNCLFQSLYGSIPSLTPPNP---TNLHKNQDFLYKFFKEKSLYFRQNEEYIVSNTKIGLIK
ADEN_ADEO7/21-199 GFLGIFDCRFPGFLQKSKIQTAIINTGPREQGGIHWITLALEPISYKLFIFDPLGWKDTQLIKFYNFSLNSLIKRSALN-NSDRCITVERNTQSVQCTCAGSCGLFCIFFLYCFHFYKQNVFKSWLFQKLNGSTPSLIPCEP---HLLHENQTFLYDFLNAKSVYFRKNYRTFIENTKTGLIK
P87664_9ADEN/21-199 NFLGTFDCTFPGFINKHKRQTAIINTGSRASGGLHWLAFAWDPLRYTIYMFDPLGWKEKDLFKLYGFSYKTMIKRSALQ-SDNRCVKLVKNTEAVQCTCAGSCGLFCVFFLYCFNLCHINPFEASIFQAMHGTSPALYPSKP---HLLHANQQMLYDFLRSHSSYFVNNERTLVCNTKLNLIN