EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00739 alignment
(4 sequences with 145 aa)


Q80JC8_HPBV0/1-142 MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSA--RRMETTVNAHQVLPKVLHKRTLGLSAMSTTDL-EAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLV
Q80IS4_HPBV0/1-142 MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSA--RRMETTVNDHRNLSKVLHKRTLGLSAMSTTDL-EAYFKDCVFTEWEELGEEMRLMIFVLGGCRHKLV
Q806D2_HPBV0/1-142 MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVSTDHGAHLSLRGLPVCAFSCAGPCALRFTSA--RRMETTVNAHRILSKDLRTMTLELSGLSTSDL-EAYFKDRVFTEWEELGEEIRLMIFVLGGCTHTLL
X_HPBGS/1-138 MAARLCCQLDSSRDVLLLRPLRGQPSGPSVSGTSAGSPSSAASAFSSGHQADIPVGRLPACFYSSAGPCCLGFTCADLRTMDSTVN----FVPWHAKRQLG---MMQKDFWTAYIRDQLLTLWEEGIIDPRLKLFVLGGCRHKYM