EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00737 alignment
(16 sequences with 52 aa)


PSBH_TOBAC/15-66 RTAVGDLLKPLNSEYGKVAPGWGTTPLMGVAMALFAVFLSIILEIYNSSVLL
PSBH_SPIOL/15-66 PTTVGALLKPLNSEYGKVAPGWGTTPLMGVAMALFAVFLSIILEIYNSSVLL
PSBH_ORYSA/15-66 QTRVGNLLKPLNSEYGKVAPGWGTTPFMGVAMALFAVFLSIILEIYNSSVLL
PSBH_OENHO/15-66 KTGLGGLLKPLNSEYGKVAPGWGTTPLMGLAMALFAVFLSIILEIYNSSVLL
PSBH_PINTH/15-66 ETLVGTTLKPLNSEYGKVAPGWGTTPLMGFAMALFAVFLSIILEIYNSSVLL
PSBH_MAIZE/15-66 RTGAGSLLKPLNSEYGKVAPGWGTTPFMGVAMALFAIFLSIILEIYNSSVLL
PSBH_WHEAT/15-66 RTGAGSLLKPLNSEYGKVAPGWGTTPFMGVAMALFAIFLSIILEIYNSSVLL
PSBH_HORVU/15-66 RTGAGSLLKPLNSEYGKVAPGWGTTPFMGVAMALFAIFLSIILEIYNSSILL
PSBH_MARPO/15-66 KSGIGDILKPLNSEYGKVAPGWGTTPLMGIMMALFAVFLVVILELYNSSVLL
PSBH_SYNY3/3-54 RTRLGDILRPLNSEYGKVVPGWGTTPVMGVFMALFLVFLLIILQIYNSSLIL
PSBH_ODOSI/4-55 RTRLGEILRPLNAEYGKVAPGWGTTPIMGVVMLAFLVFLLIILQIYNSSLII
PSBH_PORPU/4-55 RTRLGEILRPLNSEYGKVAPGWGTTPIMGIFMLLFFLFLLIILQIYNSSLVL
PSBH_CYAPA/4-55 RTALGNILRPLNSEYGKVAPGWGTTPLMAVFMLLFFVFLLIIIQIYNSSLLL
PSBH_CHLRE/22-73 VTPLGTLLRPLNSEAGKVLPGWGTTVLMAVFILLFAAFLLIILEIYNSSLIL
PSBH_EUGGR/16-67 TTTLGTILKPLNSKYGKVLPGWGTAGIMLIFMTLFAIFLTIILEIYNSSVIL
PSBH_PROHO/4-55 KTALSNFLKPFNSNAGKVVPGWGTTPLMGLFMGLLFVFLLIILQIYNSTIVL